Lus10000384 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G12390 140 / 8e-44 Cornichon family protein (.1)
AT1G62880 130 / 1e-39 Cornichon family protein (.1.2)
AT1G12340 127 / 1e-38 Cornichon family protein (.1)
AT4G12090 120 / 8e-36 Cornichon family protein (.1)
AT3G12180 96 / 7e-26 Cornichon family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10007000 176 / 2e-57 AT1G12390 176 / 3e-57 Cornichon family protein (.1)
Lus10006997 176 / 2e-57 AT1G12390 176 / 3e-57 Cornichon family protein (.1)
Lus10028906 167 / 4e-54 AT1G12390 207 / 2e-70 Cornichon family protein (.1)
Lus10004320 149 / 3e-46 AT1G12390 173 / 1e-55 Cornichon family protein (.1)
Lus10009295 112 / 8e-33 AT1G12390 142 / 7e-45 Cornichon family protein (.1)
Lus10015866 100 / 4e-28 AT1G12390 128 / 1e-39 Cornichon family protein (.1)
Lus10004023 91 / 6e-24 AT1G12340 101 / 5e-30 Cornichon family protein (.1)
Lus10030270 82 / 5e-21 AT1G12390 94 / 2e-26 Cornichon family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G116100 162 / 2e-52 AT1G12390 184 / 3e-61 Cornichon family protein (.1)
Potri.003G116400 149 / 4e-47 AT1G12390 182 / 2e-60 Cornichon family protein (.1)
Potri.002G148500 88 / 4e-23 AT1G12390 106 / 9e-31 Cornichon family protein (.1)
Potri.006G057300 81 / 3e-20 AT3G12180 109 / 3e-31 Cornichon family protein (.1)
Potri.016G051000 79 / 2e-19 AT3G12180 142 / 4e-44 Cornichon family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF03311 Cornichon Cornichon protein
Representative CDS sequence
>Lus10000384 pacid=23159279 polypeptide=Lus10000384 locus=Lus10000384.g ID=Lus10000384.BGIv1.0 annot-version=v1.0
ATGGCCTTCTACTTCGTTATCGCCCTAATCTTCATCGTCATCTTCCAGCTTATTTCCTTGGCCGATTTGGAGTCTGATTACATCAACCCTTACGACTCTT
CATCAAGGATCAACAAAGCGATTTTTCCAGAGTACATCACCGGAGCAGCTTTGTGCTTCTTTTTCCTTGTGACTGGCCATTGGTGTATGGCACTTTTGTG
CGCTCCTTACCTTTACTACAATGTCCGCCTTTACATGCGAAGGCAGCATCTGATAGACGTGACCGAGGTTTTCAACTTGTTACGTGGTGAAATGCACCAA
CGATTATATAAGTTGGGTTATCTCATCCTCCTCCTTTTCCTAGCTATATTCTGGTATGTCAATGCTTGTTTCCCATCCTTCTTCTCGTCAAACAACGTTG
AATCTAAGCTTGATGTGCTCTCATTTTCCGCTCTGTAG
AA sequence
>Lus10000384 pacid=23159279 polypeptide=Lus10000384 locus=Lus10000384.g ID=Lus10000384.BGIv1.0 annot-version=v1.0
MAFYFVIALIFIVIFQLISLADLESDYINPYDSSSRINKAIFPEYITGAALCFFFLVTGHWCMALLCAPYLYYNVRLYMRRQHLIDVTEVFNLLRGEMHQ
RLYKLGYLILLLFLAIFWYVNACFPSFFSSNNVESKLDVLSFSAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G12390 Cornichon family protein (.1) Lus10000384 0 1
AT4G17616 Pentatricopeptide repeat (PPR)... Lus10035686 2.2 0.8527
AT5G14250 CSN3, FUS11, CO... FUSCA 11, COP9 SIGNALOSOME SUB... Lus10022337 11.9 0.8501
AT5G14250 CSN3, FUS11, CO... FUSCA 11, COP9 SIGNALOSOME SUB... Lus10041586 18.4 0.8405
AT2G34930 disease resistance family prot... Lus10016341 21.9 0.8017
AT5G27950 P-loop containing nucleoside t... Lus10033849 31.6 0.8369
AT3G44590 60S acidic ribosomal protein f... Lus10026712 41.1 0.7735
AT5G06350 ARM repeat superfamily protein... Lus10004194 46.4 0.8083
AT4G27300 S-locus lectin protein kinase ... Lus10014000 47.8 0.7541
AT2G39550 GGB, ATGGT-IB, ... GERANYLGERANYLTRANSFERASE-I BE... Lus10000944 50.5 0.7930
AT4G26310 elongation factor P (EF-P) fam... Lus10007884 52.2 0.8271

Lus10000384 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.