Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G67490 69 / 2e-16 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019019 [exp] 182 / 4e-61 AT5G67490 69 / 2e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G017700 [exp] 68 / 1e-15 AT5G67490 64 / 2e-14 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07896 [flax] [poplar] DUF1674 Protein of unknown function (DUF1674)
Representative CDS sequence Show only first row Show all	>Lus10000389 pacid=23146073 polypeptide=Lus10000389 locus=Lus10000389.g ID=Lus10000389.BGIv1.0 annot-version=v1.0 ATGGCGAGAACCAATCTCGGGCGTTTATTCTCATCGATCTCCGATCTCGCGGCGGTCAGATCCGACCCGGATATCAAGGTTAACGCCGCTTCCAACACGC TGCGCAGGTTCTTGAGCTCCACGACGACTCACCAACCGGAGCCGGAGAATACGAGCAAAATCAATCCGAGTGCTGATCCTGAAAGCGAGAAGAGATCGAA GGAACAAGAGGCGGAGGAGGATGGAGAGGAAGATGGGGACGACTATGGAGTTAACAAGGAGACGGGAGAGATCGGCGGTCCGAGAGGTCCCGAGCCCACT AGATACGGCGATTGGGAGCAAAAAGGCCGATGCTCCGATTTCTGA
AA sequence Show only first row Show all	>Lus10000389 pacid=23146073 polypeptide=Lus10000389 locus=Lus10000389.g ID=Lus10000389.BGIv1.0 annot-version=v1.0 MARTNLGRLFSSISDLAAVRSDPDIKVNAASNTLRRFLSSTTTHQPEPENTSKINPSADPESEKRSKEQEAEEDGEEDGDDYGVNKETGEIGGPRGPEPT RYGDWEQKGRCSDF

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G67490			unknown protein		Lus10000389 [exp]	0	1
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10022525 [exp]	3.3	0.8480
AT5G61310			Cytochrome c oxidase subunit V...		Lus10025028 [exp]	4.5	0.8301
AT5G51880			2-oxoglutarate (2OG) and Fe(II...		Lus10038893 [exp]	5.3	0.8418
AT5G65270		AtRABA4a	RAB GTPase homolog A4A (.1)		Lus10035924 [exp]	6.0	0.8364
AT1G21900			emp24/gp25L/p24 family/GOLD fa...		Lus10041939 [exp]	8.1	0.8135
AT1G33520		MOS2	modifier of snc1, 2, D111/G-pa...		Lus10004541 [exp]	8.9	0.7973
AT4G17370			Oxidoreductase family protein ...		Lus10028967 [exp]	10.1	0.7588
AT4G33740			unknown protein		Lus10012453 [exp]	10.6	0.8022
AT1G50740			Transmembrane proteins 14C (.1...		Lus10019624 [exp]	12.8	0.7971
AT5G54750			Transport protein particle (TR...		Lus10028720 [exp]	14.4	0.7955

Compare expression of checked genes

Lus10000389 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.