Lus10000397 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G05960 139 / 1e-43 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT3G53980 135 / 3e-42 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
AT2G37870 82 / 4e-21 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
AT5G48485 41 / 2e-05 DIR1 DEFECTIVE IN INDUCED RESISTANCE 1, Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009872 226 / 6e-78 AT5G05960 148 / 2e-47 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10004677 163 / 6e-53 AT5G05960 142 / 8e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10031925 74 / 4e-17 AT2G37870 133 / 1e-40 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Lus10040249 65 / 6e-15 AT3G53980 42 / 2e-06 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Lus10011358 43 / 8e-06 AT1G27950 103 / 5e-28 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Lus10006413 40 / 0.0002 AT1G27950 137 / 5e-41 glycosylphosphatidylinositol-anchored lipid protein transfer 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G061800 177 / 7e-59 AT5G05960 155 / 3e-50 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G196300 172 / 7e-57 AT5G05960 150 / 2e-48 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.016G104300 138 / 3e-43 AT3G53980 143 / 2e-45 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1.2)
Potri.008G141000 88 / 4e-23 AT2G37870 121 / 2e-36 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
Potri.010G100600 80 / 4e-20 AT2G37870 122 / 3e-37 Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0482 Prolamin PF00234 Tryp_alpha_amyl Protease inhibitor/seed storage/LTP family
Representative CDS sequence
>Lus10000397 pacid=23147827 polypeptide=Lus10000397 locus=Lus10000397.g ID=Lus10000397.BGIv1.0 annot-version=v1.0
ATGGCTGCTTCGATGAAGTTGTGCATTTGTCTTGTGGGGTTGGCTGTGGTATTTGGGATGTCTGGGTTTGCTGTGGATGGAGCTGGTGAGTGTGGGAAAT
CCACCAACCCAGACAGGGAAGCATTCAAGCTAGCTCCCTGCGCATCAGCAGCACAGGATGAGAATTCTGCGGTTTCAAGCCAGTGCTGTGCTGCGGTGAA
GAAGCTTGGGCAGAACCCAGCTTGCCTCTGTGCTGTGATGCTTTCCAATACTGCTAAGAGCTCTGGGGTTAAGCCAGAAGTGGCCATGGCCATCCCCAAA
CGCTGCAACATTGCTGACCGTCCCGTTGGTTATAAGTGTGGAGGCATGCCACTGACATATATAATTGACTCAAATTCTTTCCATGTGTTTCTGTAG
AA sequence
>Lus10000397 pacid=23147827 polypeptide=Lus10000397 locus=Lus10000397.g ID=Lus10000397.BGIv1.0 annot-version=v1.0
MAASMKLCICLVGLAVVFGMSGFAVDGAGECGKSTNPDREAFKLAPCASAAQDENSAVSSQCCAAVKKLGQNPACLCAVMLSNTAKSSGVKPEVAMAIPK
RCNIADRPVGYKCGGMPLTYIIDSNSFHVFL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05960 Bifunctional inhibitor/lipid-t... Lus10000397 0 1
Lus10038207 1.4 0.8698
AT4G39090 EMB3005, RD19A,... RESPONSIVE TO DEHYDRATION 19A,... Lus10028797 5.0 0.8793
AT5G02090 unknown protein Lus10024357 6.0 0.8595
AT3G08860 PYD4 PYRIMIDINE 4 (.1) Lus10009086 7.4 0.8408
AT3G47160 RING/U-box superfamily protein... Lus10006447 10.0 0.8556
AT3G47160 RING/U-box superfamily protein... Lus10011390 12.0 0.8319
AT3G52360 unknown protein Lus10016198 12.6 0.7905
AT1G75410 HD BLH3 BEL1-like homeodomain 3 (.1.2) Lus10010633 12.6 0.8339
AT1G22170 Phosphoglycerate mutase family... Lus10033465 13.9 0.8173
AT1G75900 EXL3 GDSL-like Lipase/Acylhydrolase... Lus10034542 14.6 0.6878

Lus10000397 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.