Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G05950 130 / 2e-39 MEE60 maternal effect embryo arrest 60 (.1) AT2G01580 74 / 3e-17 unknown protein AT3G07510 59 / 2e-11 unknown protein AT3G46890 58 / 3e-11 unknown protein AT3G60830 44 / 1e-05 ATARP7 actin-related protein 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009873 [exp] 223 / 6e-76 AT5G05950 201 / 2e-66 maternal effect embryo arrest 60 (.1) Lus10016474 [exp] 99 / 6e-27 AT5G05950 183 / 3e-59 maternal effect embryo arrest 60 (.1) Lus10040757 [exp] 103 / 1e-26 AT5G59070 597 / 0.0 UDP-Glycosyltransferase superfamily protein (.1) Lus10025856 [exp] 66 / 3e-14 AT3G07510 244 / 3e-83 unknown protein Lus10038243 [exp] 66 / 5e-14 AT3G07510 243 / 2e-82 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G196100 [exp] 130 / 2e-39 AT5G05950 181 / 2e-58 maternal effect embryo arrest 60 (.1) Potri.009G038500 [exp] 102 / 3e-28 AT5G05950 150 / 2e-46 maternal effect embryo arrest 60 (.1) Potri.014G176000 [exp] 67 / 2e-14 AT3G07510 207 / 2e-68 unknown protein Potri.002G239500 [exp] 65 / 7e-14 AT3G07510 202 / 8e-67 unknown protein Potri.014G176300 [exp] 65 / 8e-14 AT3G07510 144 / 1e-43 unknown protein Potri.014G176400 [exp] 63 / 7e-13 AT3G07510 122 / 1e-34 unknown protein Potri.009G060200 [exp] 39 / 0.0004 AT3G60830 615 / 0.0 actin-related protein 7 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000398 pacid=23147826 polypeptide=Lus10000398 locus=Lus10000398.g ID=Lus10000398.BGIv1.0 annot-version=v1.0 ATGGGTAGCAGCAGCATTCACATGACGGCACTCGACGGAATCGTCAACGTCAACTCCCTCTTGACATTCGCCGTCTTTATCGGCCTCGCCTGGAACCCCC TCGACCGTTCCGACACTCTGATTACGGATCCAACTTGCACAGCCAGCCGCAGCGTGGCCGAGGATCTCATCTCTTTCCATGTCTACTCATTCAGCTGTTT CCTCATCTCCAGCTTGGTCGCCCTCGCTCTCAAGCAGGCCATTCGTATCTCCCGCAACCCTGACCACTCCGGCATCGACAACGCCATCGCCCAATTCCAT CTCCCCAAGTTCCTGGGCCAAGTGAACAAGAATCTCCTCCGGATCGGAATGCTGGTCTCCGGAATCGGTTCTTTGGTTTCGATCTAG
AA sequence Show only first row Show all	>Lus10000398 pacid=23147826 polypeptide=Lus10000398 locus=Lus10000398.g ID=Lus10000398.BGIv1.0 annot-version=v1.0 MGSSSIHMTALDGIVNVNSLLTFAVFIGLAWNPLDRSDTLITDPTCTASRSVAEDLISFHVYSFSCFLISSLVALALKQAIRISRNPDHSGIDNAIAQFH LPKFLGQVNKNLLRIGMLVSGIGSLVSI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05950		MEE60	maternal effect embryo arrest ...		Lus10000398 [exp]	0	1
AT3G60380			unknown protein		Lus10042896 [exp]	91.4	0.6236
AT4G30160		ATVLN4, VLN4	villin 4 (.1.2)		Lus10015334 [exp]	96.0	0.6160
AT1G73590		ATPIN1, PIN1	ARABIDOPSIS THALIANA PIN-FORME...		Lus10042004 [exp]	99.2	0.6531

Compare expression of checked genes

Lus10000398 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.