Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10004459 [exp] 107 / 2e-32 AT5G27810 46 / 6e-08 MADS-box transcription factor family protein (.1) Lus10001689 [exp] 101 / 4e-30 AT5G27810 51 / 5e-10 MADS-box transcription factor family protein (.1) Lus10022316 [exp] 67 / 8e-15 AT5G48670 131 / 2e-36 AGAMOUS-like 80 (.1) Lus10007711 [exp] 62 / 4e-14 AT5G48670 83 / 5e-20 AGAMOUS-like 80 (.1) Lus10014883 [exp] 65 / 5e-14 AT5G48670 114 / 1e-29 AGAMOUS-like 80 (.1) Lus10022325 [exp] 63 / 2e-13 AT1G65300 113 / 1e-30 PHERES2, AGAMOUS-like 38 (.1) Lus10007713 [exp] 59 / 1e-12 AT1G65330 74 / 1e-16 PHERES1, AGAMOUS-like 37, MADS-box transcription factor family protein (.1) Lus10014578 [exp] 49 / 2e-08 AT5G48670 182 / 5e-56 AGAMOUS-like 80 (.1) Lus10032108 [exp] 46 / 3e-07 AT5G48670 180 / 9e-55 AGAMOUS-like 80 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G002400 [exp] 44 / 2e-06 AT5G48670 222 / 4e-71 AGAMOUS-like 80 (.1) Potri.013G018100 [exp] 40 / 4e-05 AT5G48670 187 / 1e-58 AGAMOUS-like 80 (.1) Potri.013G001700 [exp] 39 / 6e-05 AT5G48670 203 / 3e-64 AGAMOUS-like 80 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00319 [flax] [poplar] SRF-TF SRF-type transcription factor (DNA-binding and dimerisation domain)
Representative CDS sequence Show only first row Show all	>Lus10000400 pacid=23164648 polypeptide=Lus10000400 locus=Lus10000400.g ID=Lus10000400.BGIv1.0 annot-version=v1.0 ATGGCGTCATTGAAGAAACGGAAGAGCAGGCTAATGAAGAAAGTGAAGGAGCTGAGCACCCTCAAAGCCATCCAAGCCTACACCATCGTCAACAACCGGT ACGATGAGGCGCAACCGTCGGAGACTTGGACGCCAATGCTAGACGGGGTCCACTATGTCCTAGACGGGGTCCACTATGTTCTACCCCGTATTAAGAATAT GCCCAAGATGGACCAGAACAAGAATATGGTCAACTAG
AA sequence Show only first row Show all	>Lus10000400 pacid=23164648 polypeptide=Lus10000400 locus=Lus10000400.g ID=Lus10000400.BGIv1.0 annot-version=v1.0 MASLKKRKSRLMKKVKELSTLKAIQAYTIVNNRYDEAQPSETWTPMLDGVHYVLDGVHYVLPRIKNMPKMDQNKNMVN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000400 [exp]	0	1
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10029390 [exp]	1.0	1.0000
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10029913 [exp]	1.4	1.0000
					Lus10009372 [exp]	2.2	1.0000
AT3G45600		TET3	tetraspanin3 (.1)		Lus10023218 [exp]	2.6	0.9926
AT2G29110		ATGLR2.8	glutamate receptor 2.8 (.1)		Lus10026877 [exp]	3.5	1.0000
AT5G63810		BGAL10	beta-galactosidase 10 (.1)		Lus10023977 [exp]	4.0	0.9889
AT5G18460			Protein of Unknown Function (D...		Lus10006860 [exp]	4.5	1.0000
AT5G47880		ERF1-1	eukaryotic release factor 1-1 ...		Lus10031479 [exp]	5.1	0.9214
AT5G19580			glyoxal oxidase-related protei...		Lus10043230 [exp]	5.2	0.9620
AT4G29280		LCR22	low-molecular-weight cysteine-...		Lus10015983 [exp]	5.5	1.0000

Compare expression of checked genes

Lus10000400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.