Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G57990 105 / 6e-28 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10016269 [exp] 114 / 6e-34 ND 169 / 1e-52 Lus10012012 [exp] 112 / 7e-33 ND 164 / 2e-50 Lus10016270 [exp] 114 / 1e-31 AT3G57990 300 / 4e-100 unknown protein Lus10012013 [exp] 112 / 8e-31 AT3G57990 296 / 3e-98 unknown protein Lus10021042 [exp] 91 / 8e-23 AT3G57990 341 / 6e-116 unknown protein Lus10004184 [exp] 91 / 1e-22 AT3G57990 329 / 3e-111 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G046900 [exp] 103 / 9e-28 AT3G57990 345 / 3e-118 unknown protein Potri.006G191800 [exp] 100 / 5e-26 AT3G57990 299 / 1e-99 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000401 pacid=23149324 polypeptide=Lus10000401 locus=Lus10000401.g ID=Lus10000401.BGIv1.0 annot-version=v1.0 ATGAGTTCATCTTCTTCCATCGTCATCTTCTTCCATCATCATCTTCTTCCTCTTATTTGTTCACCAGCGATTCCTCTTCTTCTTATTCTTCTTCTTCTTT ATTTAGAGCAAATCAAAGATGAAAGCCTTACTCAGATTCCTCTCAACATCCCCGGCTTCCCATTCTTGTTAGGTATCATCGACGGAGACTCCAAGGAGCT CTTTCTCAAACTCTCGACGTTCTTTGATTCCGGTCCGTCACTCAAGGTCGCGTACCGCCCCAATGATTCATGGAAAGCGTTCTCGCTCGTGGTCAAGACA GGGACGGCGGATTTCGGATCGCTGATCTCCAACCCGCTGGTGATGAGCGCCAAGTATTAG
AA sequence Show only first row Show all	>Lus10000401 pacid=23149324 polypeptide=Lus10000401 locus=Lus10000401.g ID=Lus10000401.BGIv1.0 annot-version=v1.0 MSSSSSIVIFFHHHLLPLICSPAIPLLLILLLLYLEQIKDESLTQIPLNIPGFPFLLGIIDGDSKELFLKLSTFFDSGPSLKVAYRPNDSWKAFSLVVKT GTADFGSLISNPLVMSAKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G57990			unknown protein		Lus10000401 [exp]	0	1
AT5G53480			ARM repeat superfamily protein...		Lus10031905 [exp]	4.5	0.7018
					Lus10026442 [exp]	5.2	0.7715
					Lus10022970 [exp]	7.2	0.7558
AT5G03250			Phototropic-responsive NPH3 fa...		Lus10009292 [exp]	8.8	0.7015
					Lus10039737 [exp]	10.4	0.7275
AT2G31500		CPK24	calcium-dependent protein kina...		Lus10025570 [exp]	10.8	0.7107
AT1G19250		FMO1	flavin-dependent monooxygenase...		Lus10005178 [exp]	12.5	0.7417
AT3G26720			Glycosyl hydrolase family 38 p...		Lus10014259 [exp]	16.7	0.6714
AT2G42000		AtMT4a	Arabidopsis thaliana metalloth...		Lus10022998 [exp]	22.1	0.7123
AT5G20260			Exostosin family protein (.1)		Lus10027707 [exp]	27.7	0.6121

Compare expression of checked genes

Lus10000401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.