Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G17455 149 / 1e-47 ELF4-L4 ELF4-like 4 (.1.2) AT1G72630 144 / 5e-46 ELF4-L2 ELF4-like 2 (.1) AT2G06255 137 / 3e-43 ELF4-L3 ELF4-like 3 (.1) AT2G40080 77 / 2e-19 ELF4 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1) AT2G29950 76 / 6e-19 ELF4-L1 ELF4-like 1 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10001250 [exp] 229 / 3e-79 AT1G17455 148 / 1e-47 ELF4-like 4 (.1.2) Lus10000371 [exp] 221 / 4e-76 AT1G17455 140 / 2e-44 ELF4-like 4 (.1.2) Lus10018237 [exp] 85 / 3e-22 AT2G29950 112 / 6e-33 ELF4-like 1 (.1) Lus10040667 [exp] 84 / 8e-22 AT2G29950 108 / 4e-31 ELF4-like 1 (.1) Lus10028288 [exp] 68 / 6e-16 AT2G40080 110 / 1e-32 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G170100 [exp] 174 / 1e-57 AT1G17455 158 / 1e-51 ELF4-like 4 (.1.2) Potri.003G063900 [exp] 173 / 2e-57 AT1G17455 156 / 7e-51 ELF4-like 4 (.1.2) Potri.006G143800 [exp] 172 / 5e-57 AT1G17455 166 / 1e-54 ELF4-like 4 (.1.2) Potri.019G131700 [exp] 112 / 3e-33 AT2G06255 107 / 2e-31 ELF4-like 3 (.1) Potri.008G068200 [exp] 89 / 8e-24 AT2G40080 112 / 2e-33 EARLY FLOWERING 4, Protein of unknown function (DUF1313) (.1) Potri.001G251600 [exp] 85 / 3e-22 AT2G29950 109 / 6e-32 ELF4-like 1 (.1) Potri.009G046400 [exp] 81 / 1e-20 AT2G29950 99 / 6e-28 ELF4-like 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07011 [flax] [poplar] Elf4 Early Flowering 4 domain
Representative CDS sequence Show only first row Show all	>Lus10000408 pacid=23180860 polypeptide=Lus10000408 locus=Lus10000408.g ID=Lus10000408.BGIv1.0 annot-version=v1.0 ATGGAAGGTGATTTATTCTCAGGTTTAGGTAATAATGGGATGCAGGTAGACAGCAAGGCATTGCAGACGTTTCAGGGAAGTTTTCGGCAAGTTCAAGACA TCCTAGATCAGAACAGGTTGCTCATTAATGAGATAAACCAAAACCATGAATCGAAGATCCCAGATAACTTGAGTCGAAATGTTGGATTGATTAGAGAGCT GAACAACAACATTAGAAGGGTTGTAGATCTCTATTCTGGTATTTCTACAGAGTTCGCGAGGTCAATGGAAACCACTTCGGATGGTGATTCAACTGGGGTC TTGAAAGCCAATGGAAAGTCCAGTCAAAAGAGGAATAGGTTTGGTAATTGA
AA sequence Show only first row Show all	>Lus10000408 pacid=23180860 polypeptide=Lus10000408 locus=Lus10000408.g ID=Lus10000408.BGIv1.0 annot-version=v1.0 MEGDLFSGLGNNGMQVDSKALQTFQGSFRQVQDILDQNRLLINEINQNHESKIPDNLSRNVGLIRELNNNIRRVVDLYSGISTEFARSMETTSDGDSTGV LKANGKSSQKRNRFGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G17455		ELF4-L4	ELF4-like 4 (.1.2)		Lus10000408 [exp]	0	1
AT2G06530		VPS2.1	SNF7 family protein (.1)		Lus10037660 [exp]	2.2	0.9199
AT4G05530		SDRA, IBR1	SHORT-CHAIN DEHYDROGENASE/REDU...		Lus10020019 [exp]	3.0	0.9236
AT4G29890			choline monooxygenase, putativ...		Lus10008571 [exp]	3.7	0.9374
AT5G45130		ATRAB-F2A, RHA1...	ARABIDOPSIS RAB HOMOLOG F2A, R...		Lus10038334 [exp]	5.3	0.9201
AT5G23760			Copper transport protein famil...		Lus10039224 [exp]	5.7	0.8990
AT4G26060			Ribosomal protein L18ae family...		Lus10011943 [exp]	8.5	0.9247
AT1G21780			BTB/POZ domain-containing prot...		Lus10042717 [exp]	16.1	0.9027
AT5G61310			Cytochrome c oxidase subunit V...		Lus10010008 [exp]	16.2	0.8800
AT5G57000			unknown protein		Lus10006884 [exp]	16.5	0.8956
AT1G01490			Heavy metal transport/detoxifi...		Lus10007911 [exp]	17.5	0.8914

Compare expression of checked genes

Lus10000408 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.