Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024503 [exp] 135 / 9e-43 ND 36 / 0.002 Lus10024780 [exp] 129 / 4e-40 ND 40 / 2e-04 Lus10033313 [exp] 129 / 1e-37 AT1G17930 72 / 1e-13 Aminotransferase-like, plant mobile domain family protein (.1) Lus10031075 [exp] 119 / 1e-36 AT1G17930 45 / 1e-06 Aminotransferase-like, plant mobile domain family protein (.1) Lus10005495 [exp] 122 / 3e-36 AT1G17930 54 / 2e-08 Aminotransferase-like, plant mobile domain family protein (.1) Lus10039393 [exp] 122 / 1e-35 AT1G17930 73 / 3e-14 Aminotransferase-like, plant mobile domain family protein (.1) Lus10008249 [exp] 119 / 3e-35 ND 40 / 3e-04 Lus10018964 [exp] 117 / 1e-34 ND / Lus10004830 [exp] 115 / 3e-33 AT1G17930 48 / 4e-06 Aminotransferase-like, plant mobile domain family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10536 [flax] [poplar] PMD Plant mobile domain
Representative CDS sequence Show only first row Show all	>Lus10000410 pacid=23163936 polypeptide=Lus10000410 locus=Lus10000410.g ID=Lus10000410.BGIv1.0 annot-version=v1.0 ATGCACCGTCGGTTGGATTATTATCGTCGTCTGCTTGATGATATGACTGCACGGGATATGACCTGGCTGCCATTTGGCCCACGTCCCGAGGTAGAGGTTT CCGATTCAGCATTTTGTGGAGTGATTCGTTTCACGACGACTGCAAAGTACTACTATCCGACACGTATCGTTTGGCAGTTCGGCTACGCGCAGACGATTCC AGGGCTTATCCTTGCTCCTGCCAGGGCAATTAGGTCGGCTAAGCCTAATGTTTACCTGGTTGAGTGGGTTGACAGCACCGATAGAGCATGGAGCCACGAG GACTAG
AA sequence Show only first row Show all	>Lus10000410 pacid=23163936 polypeptide=Lus10000410 locus=Lus10000410.g ID=Lus10000410.BGIv1.0 annot-version=v1.0 MHRRLDYYRRLLDDMTARDMTWLPFGPRPEVEVSDSAFCGVIRFTTTAKYYYPTRIVWQFGYAQTIPGLILAPARAIRSAKPNVYLVEWVDSTDRAWSHE D

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000410 [exp]	0	1

Compare expression of checked genes

Lus10000410 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.