Lus10000421 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G08180 219 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT4G12600 59 / 1e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
AT5G20160 58 / 3e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2.3)
AT4G22380 58 / 3e-11 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT2G47610 45 / 6e-06 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
AT3G62870 41 / 0.0001 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010993 281 / 1e-98 AT5G08180 229 / 3e-78 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10040161 251 / 5e-87 AT5G08180 226 / 4e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10004366 251 / 1e-86 AT5G08180 227 / 1e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Lus10017031 61 / 3e-12 AT4G22380 220 / 2e-75 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10019420 62 / 6e-12 AT5G55190 443 / 8e-159 RAN GTPase 3 (.1)
Lus10043276 62 / 6e-12 AT5G55190 428 / 9e-153 RAN GTPase 3 (.1)
Lus10015295 56 / 9e-10 AT4G22380 217 / 7e-72 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10025435 55 / 2e-09 AT4G22380 203 / 7e-66 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Lus10010763 42 / 7e-05 AT3G62870 441 / 3e-159 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G110100 237 / 2e-81 AT5G08180 225 / 8e-77 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.013G116800 60 / 4e-12 AT4G12600 216 / 3e-74 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.019G087100 57 / 5e-11 AT4G12600 213 / 9e-73 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1.2)
Potri.004G113800 42 / 6e-05 AT3G62870 399 / 5e-142 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G100800 42 / 7e-05 AT3G62870 377 / 1e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.017G101000 42 / 7e-05 AT3G62870 376 / 3e-133 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.004G113900 40 / 0.0002 AT3G62870 362 / 7e-127 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
Potri.001G326400 39 / 0.0005 AT2G47610 385 / 1e-136 Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0101 PELOTA PF01248 Ribosomal_L7Ae Ribosomal protein L7Ae/L30e/S12e/Gadd45 family
Representative CDS sequence
>Lus10000421 pacid=23142584 polypeptide=Lus10000421 locus=Lus10000421.g ID=Lus10000421.BGIv1.0 annot-version=v1.0
ATGGGAAGCGACAGCGAAACGGAGAAGTCGCAGAAGAAAGAAAAGAAGACGACTCCAGTAACTCTAGCTCCTATCGCTAAGCCCCTCGCCGGAAAGAAGC
TCTGCAAGCGGACATTCAAGCTCGTCCGCAGAGCTGCTGATAACAAGTGTTTGAAAAGAGGAGTGAAGGAGGTTGTCAAGAGCATCAGACGTGGGAATAA
AGGGATATGCATCATTGCCGGGAACATATCTCCGATCGATGTCATAACTCACGTCCCAATACTGTGTGAAGAGGCTGAAGTTCCATACTTCTACGTTCCT
TCAAAAGAAGATCTTGCAACTGCAGGAAACACGAAGAGGCCTACGTGCTGCGTTTTGGTCCAGATGAAGCCTGCCAAGGGAGAGTTGGCTAAAGAAGAAC
AAGAGAAGTTGAAGTCTGATTATGATCAAGTTGTAGCTGATGTATCTGAACTCAGTTCTTCTCTTTTCTGA
AA sequence
>Lus10000421 pacid=23142584 polypeptide=Lus10000421 locus=Lus10000421.g ID=Lus10000421.BGIv1.0 annot-version=v1.0
MGSDSETEKSQKKEKKTTPVTLAPIAKPLAGKKLCKRTFKLVRRAADNKCLKRGVKEVVKSIRRGNKGICIIAGNISPIDVITHVPILCEEAEVPYFYVP
SKEDLATAGNTKRPTCCVLVQMKPAKGELAKEEQEKLKSDYDQVVADVSELSSSLF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G08180 Ribosomal protein L7Ae/L30e/S1... Lus10000421 0 1
AT1G76010 Alba DNA/RNA-binding protein (... Lus10005615 3.0 0.9263
AT2G36620 RPL24A ribosomal protein L24 (.1) Lus10006314 3.2 0.9370
AT5G10360 RPS6B, EMB3010 Ribosomal protein small subuni... Lus10027260 3.2 0.9540
AT2G34160 Alba DNA/RNA-binding protein (... Lus10002901 3.9 0.9211
AT2G34480 Ribosomal protein L18ae/LX fam... Lus10014035 4.2 0.9514
AT3G25520 PGY3, ATL5, OLI... RIBOSOMAL PROTEIN L5 A, PIGGYB... Lus10004874 5.7 0.9531
AT2G37990 ribosome biogenesis regulatory... Lus10019422 5.7 0.9098
AT1G15420 unknown protein Lus10030351 6.0 0.9208
AT4G15640 unknown protein Lus10033970 7.1 0.9208
AT2G03670 CDC48B cell division cycle 48B (.1) Lus10018033 7.3 0.8954

Lus10000421 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.