Plant FIBer expression Database

Lus10000431 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31450 145 / 4e-43 ATNTH1 DNA glycosylase superfamily protein (.1.2)
AT1G05900 135 / 1e-39 ATNTH2 endonuclease III 2 (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10025575
[exp]
196 / 4e-62 AT2G31450 424 / 1e-147 DNA glycosylase superfamily protein (.1.2)
Lus10027037
[exp]
187 / 3e-59 AT2G31450 416 / 3e-145 DNA glycosylase superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.007G127600
[exp]
158 / 7e-48 AT2G31450 421 / 3e-147 DNA glycosylase superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0198 HHH PF00730 HhH-GPD HhH-GPD superfamily base excision DNA repair protein
Representative CDS sequence
>Lus10000431 pacid=23152240 polypeptide=Lus10000431 locus=Lus10000431.g ID=Lus10000431.BGIv1.0 annot-version=v1.0
ATGGTTAGTATACGTAATATAGGCGAGCCACCTGTAAACTGGGAAAAGATCCTTGATGGAATTCGCAAGATGCGATCTTCTGAAGATGCTCCTGTAGATA
CTATGGGATGTGAGAAAGCTGGAAATTCTCTTCCTACTAAGATATCCTTTCTATTTGCAGGAGCAATTCAACGTCTCGGTCAGAATGGGTTGCTTCATCC
TGATGCTGTTGAAAAGGCAGATGAAACAACAATCAAAGATTTGATTTATCCCGTTGGTTTCTATACAAGAAAAGCAAGCAATATGAAGAAGATTGCAAAA
ATTTGTCTTACAAAATATGACGGGATATACCGAATCAACCCTAATCCAAAAATCAAACAAATCAAAGAAACACTTTACCTTAGTAGAAAGCTGGGAGCAA
TTCGGGTGTCGTGTGTTTGGCTTTAA
AA sequence
>Lus10000431 pacid=23152240 polypeptide=Lus10000431 locus=Lus10000431.g ID=Lus10000431.BGIv1.0 annot-version=v1.0
MVSIRNIGEPPVNWEKILDGIRKMRSSEDAPVDTMGCEKAGNSLPTKISFLFAGAIQRLGQNGLLHPDAVEKADETTIKDLIYPVGFYTRKASNMKKIAK
ICLTKYDGIYRINPNPKIKQIKETLYLSRKLGAIRVSCVWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G31450 ATNTH1 DNA glycosylase superfamily pr... Lus10000431
[exp]
0 1
AT1G62350 Pentatricopeptide repeat (PPR)... Lus10000892
[exp]
2.0 0.8034
AT2G28100 ATFUC1 alpha-L-fucosidase 1 (.1) Lus10027390
[exp]
7.7 0.7738
AT2G32460 MYB ATMYB101, AtM1 ARABIDOPSIS THALIANA MYB 1, my... Lus10040063
[exp]
9.8 0.7860
AT5G22460 alpha/beta-Hydrolases superfam... Lus10020603
[exp]
10.2 0.7584
AT5G24090 ATCHIA chitinase A (.1) Lus10040419
[exp]
12.7 0.7708
AT3G60460 MYB DUO1 DUO POLLEN 1, myb-like HTH tra... Lus10009780
[exp]
13.7 0.8033
AT4G24190 AtHsp90-7, HSP9... SHEPHERD, HEAT SHOCK PROTEIN 9... Lus10035109
[exp]
16.0 0.7831
AT1G07380 Neutral/alkaline non-lysosomal... Lus10034565
[exp]
22.3 0.7704
AT1G18010 Major facilitator superfamily ... Lus10043370
[exp]
25.9 0.7649
AT1G74830 Protein of unknown function, D... Lus10033123
[exp]
26.2 0.7667

Lus10000431 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.