Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G13970 155 / 7e-51 APG12B, APG12 AUTOPHAGY 12 B, AUTOPHAGY 12, Ubiquitin-like superfamily protein (.1) AT1G54210 154 / 1e-50 ATATG12, APG12, ATG12a AUTOPHAGY 12 A, AUTOPHAGY 12, Ubiquitin-like superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006527 [exp] 103 / 2e-29 AT3G13970 74 / 2e-17 AUTOPHAGY 12 B, AUTOPHAGY 12, Ubiquitin-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G169700 [exp] 181 / 5e-61 AT1G54210 152 / 7e-50 AUTOPHAGY 12 A, AUTOPHAGY 12, Ubiquitin-like superfamily protein (.1.2) Potri.003G064300 [exp] 176 / 2e-59 AT1G54210 154 / 2e-50 AUTOPHAGY 12 A, AUTOPHAGY 12, Ubiquitin-like superfamily protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF04110 [flax] [poplar] APG12 Ubiquitin-like autophagy protein Apg12
Representative CDS sequence Show only first row Show all	>Lus10000432 pacid=23161048 polypeptide=Lus10000432 locus=Lus10000432.g ID=Lus10000432.BGIv1.0 annot-version=v1.0 ATGGCAGCTGAGGCGGCGAGTTCCGCACAGAAAGTGATTGTTCAGTTGAAAGCCACTGCCGACGCTCCTATACTCAAGCAAACCAAGTTCAAGATGCTTG GAACCGATAAGTTTGCCAAGGTGATCGACTTCTTGCGTCGTCAACTTCACAGAGAAACAGTGTTTGTCTATATCAACAGTGCCTTCTCGCCTAATCCTGA TGAACTAGTGATTGATCTTTTCAATAATTTTGGTGTTGATGGTAAATTGCTGGTGAACTATGCTTGTTCTGTGGCATGGGGTTGA
AA sequence Show only first row Show all	>Lus10000432 pacid=23161048 polypeptide=Lus10000432 locus=Lus10000432.g ID=Lus10000432.BGIv1.0 annot-version=v1.0 MAAEAASSAQKVIVQLKATADAPILKQTKFKMLGTDKFAKVIDFLRRQLHRETVFVYINSAFSPNPDELVIDLFNNFGVDGKLLVNYACSVAWG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G13970		APG12B, APG12	AUTOPHAGY 12 B, AUTOPHAGY 12, ...		Lus10000432 [exp]	0	1
AT3G08840			D-alanine--D-alanine ligase fa...		Lus10012211 [exp]	1.0	0.9455
AT1G68090		ANN5, ANNAT5	ANNEXIN ARABIDOPSIS THALIANA 5...		Lus10037992 [exp]	2.4	0.9140
AT1G04960			Protein of unknown function (D...		Lus10014626 [exp]	2.4	0.8971
AT2G17020			F-box/RNI-like superfamily pro...		Lus10022652 [exp]	2.6	0.8924
AT2G24990			Serine/threonine-protein kinas...		Lus10032627 [exp]	2.8	0.8923
AT2G35795			Chaperone DnaJ-domain superfam...		Lus10041420 [exp]	4.2	0.8932
AT5G50430		UBC33	ubiquitin-conjugating enzyme 3...		Lus10037459 [exp]	4.5	0.8961
					Lus10040920 [exp]	4.5	0.8971
AT3G09870			SAUR-like auxin-responsive pro...		Lus10023011 [exp]	7.3	0.8909
AT5G04260		WCRKC2	WCRKC thioredoxin 2 (.1)		Lus10038703 [exp]	9.7	0.8763

Compare expression of checked genes

Lus10000432 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.