Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58820 86 / 1e-20 Subtilisin-like serine endopeptidase family protein (.1) AT5G59120 84 / 5e-20 ATSBT4.13 subtilase 4.13 (.1) AT5G58830 84 / 7e-20 Subtilisin-like serine endopeptidase family protein (.1) AT5G59100 83 / 1e-19 Subtilisin-like serine endopeptidase family protein (.1) AT5G58840 82 / 2e-19 Subtilase family protein (.1) AT5G59130 82 / 3e-19 Subtilase family protein (.1.2) AT5G59090 82 / 3e-19 ATSBT4.12 subtilase 4.12 (.1.2.3) AT5G59190 80 / 1e-18 subtilase family protein (.1) AT5G67090 80 / 2e-18 Subtilisin-like serine endopeptidase family protein (.1) AT5G03620 79 / 4e-18 Subtilisin-like serine endopeptidase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002243 [exp] 166 / 4e-51 AT1G04110 248 / 4e-75 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10029577 [exp] 163 / 1e-50 AT1G04110 179 / 9e-51 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Lus10029570 [exp] 169 / 4e-50 AT5G67360 550 / 0.0 Subtilase family protein (.1) Lus10029575 [exp] 169 / 4e-50 AT5G67360 552 / 0.0 Subtilase family protein (.1) Lus10006307 [exp] 168 / 1e-49 AT5G67360 532 / 2e-179 Subtilase family protein (.1) Lus10006310 [exp] 168 / 1e-49 AT5G67360 542 / 0.0 Subtilase family protein (.1) Lus10029580 [exp] 167 / 3e-49 AT5G67360 536 / 0.0 Subtilase family protein (.1) Lus10006306 [exp] 166 / 2e-48 AT5G67360 555 / 0.0 Subtilase family protein (.1) Lus10002244 [exp] 163 / 1e-47 AT5G67360 567 / 0.0 Subtilase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G006570 [exp] 114 / 1e-30 AT1G04110 568 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118700 [exp] 107 / 3e-28 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.001G113700 [exp] 107 / 3e-28 AT1G04110 538 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118500 [exp] 95 / 9e-24 AT1G04110 557 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.003G118800 [exp] 94 / 3e-23 AT1G04110 585 / 0.0 STOMATAL DENSITY AND DISTRIBUTION, Subtilase family protein (.1) Potri.010G196700 [exp] 81 / 9e-19 AT5G59100 579 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.014G026600 [exp] 81 / 1e-18 AT5G67360 546 / 0.0 Subtilase family protein (.1) Potri.009G037900 [exp] 81 / 1e-18 AT5G59100 777 / 0.0 Subtilisin-like serine endopeptidase family protein (.1) Potri.009G038001 [exp] 78 / 7e-18 AT3G46850 794 / 0.0 Subtilase family protein (.1) Potri.010G196800 [exp] 78 / 9e-18 AT5G59100 599 / 0.0 Subtilisin-like serine endopeptidase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000434 pacid=23161047 polypeptide=Lus10000434 locus=Lus10000434.g ID=Lus10000434.BGIv1.0 annot-version=v1.0 ATGATTGACAGTGGCATCAAGTATGATCATCCTTCGTTTCGCGACAAAGGTATGCATCCACCTCCTGTAAAATGGAAAGGCAAGAGTGAGATCAATGGTA AGATGACTTGTAGCAACAAGCGCATTGGTGCTAGAAGCTTTGCCTCTCCGGGGAATCTTACGGAGGAGATTTTCCATGGAACCCATACTGCTGAAGATGC TGCTGGAACTGCCGTGGAAGGTGCCAATGTGTTTGGACAAGCTAATGGGACAGCAATGGGGATCGCCCCTTTTGCTCACTTAGCGATATGTACAAGGTCT GTGAAACTAGTTTTGAATGTTTTGAGAGTTCGTGTTGGCTGCAATGGATGTTGCTATAGAGGACGGTGTTGA
AA sequence Show only first row Show all	>Lus10000434 pacid=23161047 polypeptide=Lus10000434 locus=Lus10000434.g ID=Lus10000434.BGIv1.0 annot-version=v1.0 MIDSGIKYDHPSFRDKGMHPPPVKWKGKSEINGKMTCSNKRIGARSFASPGNLTEEIFHGTHTAEDAAGTAVEGANVFGQANGTAMGIAPFAHLAICTRS VKLVLNVLRVRVGCNGCCYRGRC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59120		ATSBT4.13	subtilase 4.13 (.1)		Lus10000434 [exp]	0	1
					Lus10000273 [exp]	5.5	0.7498
AT1G17930			Aminotransferase-like, plant m...		Lus10001981 [exp]	7.7	0.7498
AT1G04670			unknown protein		Lus10002298 [exp]	9.5	0.7498
AT4G34540			NmrA-like negative transcripti...		Lus10012146 [exp]	11.0	0.7498
					Lus10027667 [exp]	12.2	0.7498
					Lus10015682 [exp]	13.4	0.7498
AT4G18340			Glycosyl hydrolase superfamily...		Lus10031034 [exp]	14.5	0.7498
AT5G51030			NAD(P)-binding Rossmann-fold s...		Lus10032524 [exp]	15.5	0.7498
AT1G72200			RING/U-box superfamily protein...		Lus10029794 [exp]	16.2	0.6773
					Lus10032828 [exp]	16.4	0.7498

Compare expression of checked genes

Lus10000434 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.