Lus10000441 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G48240 62 / 7e-13 Octicosapeptide/Phox/Bem1p family protein (.1)
AT3G26510 61 / 5e-12 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
AT1G70640 50 / 2e-08 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1)
AT5G63130 50 / 3e-08 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G49920 47 / 8e-07 Octicosapeptide/Phox/Bem1p family protein (.1)
AT4G05150 45 / 5e-06 Octicosapeptide/Phox/Bem1p family protein (.1)
AT5G57610 45 / 6e-06 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT3G46920 45 / 7e-06 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
AT1G04700 42 / 6e-05 PB1 domain-containing protein tyrosine kinase (.1)
AT2G35050 42 / 7e-05 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026700 199 / 3e-66 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10036862 71 / 9e-16 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10006214 70 / 1e-15 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Lus10002938 57 / 2e-10 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10019490 55 / 6e-10 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10043341 55 / 9e-10 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1)
Lus10040006 49 / 2e-07 AT3G46920 604 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10019577 48 / 5e-07 AT3G46920 606 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Lus10001314 47 / 9e-07 AT5G57610 393 / 1e-125 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G186500 102 / 6e-28 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.010G046400 87 / 1e-21 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5)
Potri.015G083400 52 / 4e-09 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G085000 51 / 2e-08 AT5G63130 139 / 4e-42 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.012G053500 46 / 2e-06 AT3G18230 298 / 6e-92 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.004G032200 45 / 5e-06 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.018G095800 45 / 5e-06 AT5G57610 1075 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.006G170700 44 / 9e-06 AT5G57610 1087 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1)
Potri.011G041100 44 / 1e-05 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1)
Potri.001G052000 43 / 2e-05 AT1G04700 721 / 0.0 PB1 domain-containing protein tyrosine kinase (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0072 Ubiquitin PF00564 PB1 PB1 domain
Representative CDS sequence
>Lus10000441 pacid=23156107 polypeptide=Lus10000441 locus=Lus10000441.g ID=Lus10000441.BGIv1.0 annot-version=v1.0
ATGGATTTACTGACGAAATTGGTGGAGTTCTCTGGAGCTCCGGTGAGCTTGCGGTGTCAATTGCCGGAGGCCGATCTGGACGATGCTTTAGTCTCGATAG
TCTCCGACGAGGATCTGGCGAACTTGATCGAGGTGTACGGCCGATTCTCGTCTCTAAAGATTCGGGCTTTCCTTTCGATTCCGAGGAATCGGTCCCCTCT
GCTTTCCTCTTCTTCTTCATCGTCGTTGTCGTCTTCCTCTTCGTCTTTGTCGTCAGCTTCATCGTCGAATTCTTCTTCTGCGGCGACGATCGGTAGTCCG
AGGTGTTCTCGGTGTCGGATTCCGAAACCACCGGCGAAGAAGGTTGCCGCCGGTTATTATGCTCCGGGGAGCCACGGTGGTCGTGTGTACCTTGTACACA
ACGGTAATCACTGGCAATAA
AA sequence
>Lus10000441 pacid=23156107 polypeptide=Lus10000441 locus=Lus10000441.g ID=Lus10000441.BGIv1.0 annot-version=v1.0
MDLLTKLVEFSGAPVSLRCQLPEADLDDALVSIVSDEDLANLIEVYGRFSSLKIRAFLSIPRNRSPLLSSSSSSSLSSSSSSLSSASSSNSSSAATIGSP
RCSRCRIPKPPAKKVAAGYYAPGSHGGRVYLVHNGNHWQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G48240 Octicosapeptide/Phox/Bem1p fam... Lus10000441 0 1
AT3G26510 Octicosapeptide/Phox/Bem1p fam... Lus10026700 2.2 0.9738
AT1G12780 ATUGE1, UGE1 A. THALIANA UDP-GLC 4-EPIMERAS... Lus10029572 2.6 0.9797
AT1G10150 ATPP2-A10 Carbohydrate-binding protein (... Lus10007727 3.0 0.9668
AT1G21000 PLATZ transcription factor fam... Lus10000952 3.2 0.9764
AT5G49360 ATBXL1, BXL1 beta-xylosidase 1 (.1) Lus10016858 4.9 0.9761
AT4G32480 Protein of unknown function (D... Lus10011174 6.9 0.9742
AT3G01430 unknown protein Lus10014527 7.5 0.9714
AT1G69490 NAC NAP, ANAC029, A... Arabidopsis NAC domain contain... Lus10037156 8.1 0.9590
AT1G12780 ATUGE1, UGE1 A. THALIANA UDP-GLC 4-EPIMERAS... Lus10002246 8.5 0.9721
AT1G10600 AMSH2 associated molecule with the S... Lus10030613 8.5 0.9637

Lus10000441 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.