Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G67910 55 / 1e-11 unknown protein AT1G24577 52 / 1e-10 unknown protein AT5G55980 45 / 1e-07 serine-rich protein-related (.1) AT3G56500 39 / 2e-05 serine-rich protein-related (.1) AT3G13227 39 / 4e-05 serine-rich protein-related (.1) AT5G20370 39 / 6e-05 serine-rich protein-related (.1) AT5G25280 36 / 0.001 serine-rich protein-related (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026701 [exp] 110 / 1e-33 AT1G67910 56 / 5e-12 unknown protein Lus10023227 [exp] 45 / 3e-07 AT5G55980 69 / 3e-16 serine-rich protein-related (.1) Lus10008880 [exp] 45 / 3e-07 AT5G55980 63 / 1e-13 serine-rich protein-related (.1) Lus10043215 [exp] 42 / 2e-06 AT5G55980 44 / 8e-07 serine-rich protein-related (.1) Lus10034901 [exp] 42 / 3e-06 AT1G67910 49 / 6e-09 unknown protein Lus10023632 [exp] 41 / 5e-06 AT1G67910 48 / 1e-08 unknown protein Lus10011094 [exp] 41 / 7e-06 AT5G55980 44 / 1e-06 serine-rich protein-related (.1) Lus10023630 [exp] 38 / 0.0001 AT1G67910 44 / 2e-07 unknown protein Lus10001928 [exp] 37 / 0.0004 AT5G11090 177 / 3e-56 serine-rich protein-related (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G186200 [exp] 64 / 6e-15 AT1G67910 85 / 4e-23 unknown protein Potri.010G046700 [exp] 62 / 2e-14 AT1G67910 82 / 4e-22 unknown protein Potri.018G079200 [exp] 47 / 2e-08 AT1G67910 45 / 9e-08 unknown protein Potri.002G250700 [exp] 42 / 6e-06 AT3G56500 43 / 5e-06 serine-rich protein-related (.1) Potri.001G371400 [exp] 42 / 6e-06 AT5G55980 50 / 2e-08 serine-rich protein-related (.1) Potri.006G060700 [exp] 38 / 0.0001 AT5G11090 66 / 4e-14 serine-rich protein-related (.1) Potri.018G120300 [exp] 37 / 0.0002 AT5G11090 67 / 1e-14 serine-rich protein-related (.1) Potri.018G078900 [exp] 36 / 0.0003 AT3G13227 42 / 3e-06 serine-rich protein-related (.1) Potri.006G159300 [exp] 36 / 0.0003 AT1G24577 43 / 5e-07 unknown protein Potri.006G060800 [exp] 36 / 0.0008 AT5G25280 130 / 2e-37 serine-rich protein-related (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000442 pacid=23156106 polypeptide=Lus10000442 locus=Lus10000442.g ID=Lus10000442.BGIv1.0 annot-version=v1.0 ATGGAGGATTCCCAGAGCAGAGTTCATGATCTCAAGGTGGATGTTACTATGGACTGCAACGACAACAATCGCAGCAAGTTTCAACCTTTATCAACTCTTT CTTCTTCTTCTAGTAGTCATAGCAGTTGTAGCAAGAACACTACATCAGCTTGTCTTTGTTCTCCAACATCCCATGTCGGGTCGTTCCGATGCAGGCTTCA TCGGGCGCCTTCGCTTCAACGGACCAAGAGCATGGATGGTTCTTCTTAA
AA sequence Show only first row Show all	>Lus10000442 pacid=23156106 polypeptide=Lus10000442 locus=Lus10000442.g ID=Lus10000442.BGIv1.0 annot-version=v1.0 MEDSQSRVHDLKVDVTMDCNDNNRSKFQPLSTLSSSSSSHSSCSKNTTSACLCSPTSHVGSFRCRLHRAPSLQRTKSMDGSS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G67910			unknown protein		Lus10000442 [exp]	0	1
AT3G57340			Heat shock protein DnaJ, N-ter...		Lus10043277 [exp]	9.3	0.8205
AT3G14280			unknown protein		Lus10037453 [exp]	15.2	0.7837
AT3G57340			Heat shock protein DnaJ, N-ter...		Lus10019421 [exp]	16.4	0.8044
AT1G11050			Protein kinase superfamily pro...		Lus10001295 [exp]	18.2	0.7883
AT1G71840			transducin family protein / WD...		Lus10033710 [exp]	24.5	0.7530
AT1G25275			unknown protein		Lus10006792 [exp]	25.2	0.7758
AT5G07840		PIA1	phytochrome interacting ankyri...		Lus10033816 [exp]	28.0	0.7830
AT2G20740			Tetraspanin family protein (.1...		Lus10039817 [exp]	28.4	0.7796
AT4G36750			Quinone reductase family prote...		Lus10041718 [exp]	34.4	0.7526
AT3G15260			Protein phosphatase 2C family ...		Lus10009210 [exp]	40.6	0.7718

Compare expression of checked genes

Lus10000442 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.