Lus10000444 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G37710 191 / 7e-60 alpha/beta-Hydrolases superfamily protein (.1)
AT4G00500 156 / 2e-46 alpha/beta-Hydrolases superfamily protein (.1.2)
AT3G49050 147 / 1e-42 alpha/beta-Hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10030391 150 / 1e-44 AT3G49050 571 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Lus10037847 150 / 6e-44 AT4G00500 636 / 0.0 alpha/beta-Hydrolases superfamily protein (.1.2)
Lus10039240 147 / 5e-43 AT3G49050 624 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Lus10027485 144 / 8e-42 AT3G49050 616 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G086900 212 / 1e-67 AT5G37710 599 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.017G130000 209 / 1e-66 AT5G37710 609 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.014G083600 162 / 7e-49 AT4G00500 629 / 0.0 alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.002G159200 162 / 1e-48 AT4G00500 619 / 0.0 alpha/beta-Hydrolases superfamily protein (.1.2)
Potri.012G142700 158 / 4e-47 AT3G49050 654 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
Potri.015G145900 152 / 4e-45 AT3G49050 631 / 0.0 alpha/beta-Hydrolases superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0028 AB_hydrolase PF03893 Lipase3_N Lipase 3 N-terminal region
Representative CDS sequence
>Lus10000444 pacid=23157562 polypeptide=Lus10000444 locus=Lus10000444.g ID=Lus10000444.BGIv1.0 annot-version=v1.0
ATGTGGAAACGATGCACCTACATCGGCTCCGACGACAGCGCCACGTGGACAAACGCCACCCAAGACGAATTCGCTGACGTGCCGCGAATCTGCCGCCTAA
TCCTCGCCGTCTACGAGACCGACCTCTCCAACCCTAACTACATCCCCGCCGCCGGAAACTCCCTCCGGCAAGACTGCCTCATCAAACGAGTCACCTACAA
GCAAGCCAACGGCTGCTGCACTCCCTACATAATCTACCGCGACGACGTCAATAAAGAGATCGTCTTGGCCATGAGAGGGCTCAATTTGGCTAAAGAAGGG
GATTACAAAGTGTTGCTGGATAACAAATTGGGGAGGCAGATGTTCGACGGCGGGTATGTTCATCATGGGGTGTTGAAATCTGCCATTTGGGGGCTGGATC
AGGAAGGGGATAATTTGAGGAGGCTGTGGGAGGAGACTGGGTAA
AA sequence
>Lus10000444 pacid=23157562 polypeptide=Lus10000444 locus=Lus10000444.g ID=Lus10000444.BGIv1.0 annot-version=v1.0
MWKRCTYIGSDDSATWTNATQDEFADVPRICRLILAVYETDLSNPNYIPAAGNSLRQDCLIKRVTYKQANGCCTPYIIYRDDVNKEIVLAMRGLNLAKEG
DYKVLLDNKLGRQMFDGGYVHHGVLKSAIWGLDQEGDNLRRLWEETG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G37710 alpha/beta-Hydrolases superfam... Lus10000444 0 1
AT3G45640 ATMAPK3, ATMPK3 mitogen-activated protein kina... Lus10036136 2.8 0.8702
AT5G37710 alpha/beta-Hydrolases superfam... Lus10000445 4.0 0.8666
AT3G20410 CPK9 calmodulin-domain protein kina... Lus10021531 9.2 0.8536
AT3G20600 NDR1 non race-specific disease resi... Lus10043067 11.0 0.8610
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10020772 13.8 0.8381
AT1G76390 PUB43 plant U-box 43, ARM repeat sup... Lus10040659 16.3 0.7458
AT2G47160 AtBOR1, BOR1 REQUIRES HIGH BORON 1, HCO3- t... Lus10043101 16.9 0.7797
AT1G20960 EMB1507 embryo defective 1507, U5 smal... Lus10022081 17.6 0.7106
AT4G24290 MAC/Perforin domain-containing... Lus10037363 19.2 0.7299
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10007348 19.3 0.8302

Lus10000444 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.