Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description ATMG00510 179 / 1e-56 ATMG00510.1, NAD7 NADH dehydrogenase subunit 7 (.1) ATCG01110 78 / 2e-18 ATCG01110.1, NDHH NAD(P)H dehydrogenase subunit H (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015033 [exp] 186 / 6e-63 ATMG00510 171 / 2e-53 NADH dehydrogenase subunit 7 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00346 [flax] [poplar] Complex1_49kDa Respiratory-chain NADH dehydrogenase, 49 Kd subunit
Representative CDS sequence Show only first row Show all	>Lus10000460 pacid=23169180 polypeptide=Lus10000460 locus=Lus10000460.g ID=Lus10000460.BGIv1.0 annot-version=v1.0 ATGACTACAGGATCATCGGTCTACTCTACCTCAATTCACCATTTCGAACTTTATACAGAAGGTTTTTCCGTACCAGCTTCTTCTACCTATACCGCAGTTG AAGCACCTAAAGGAGAATTTGGTGTCTTTCTGGTCAGTAATGGAAGCAATCGTCCCTACCGTCGTAAAATAAGAGCACCTGGCTCTGCCCATTCACAAGG ACTCGAGTCTCTGTCCAAACATCACATGCCAGCAGATGTGGTCACCATCATAGGTACTCAAGATATTGTGTTTGGAGAGGTGGATAGATAG
AA sequence Show only first row Show all	>Lus10000460 pacid=23169180 polypeptide=Lus10000460 locus=Lus10000460.g ID=Lus10000460.BGIv1.0 annot-version=v1.0 MTTGSSVYSTSIHHFELYTEGFSVPASSTYTAVEAPKGEFGVFLVSNGSNRPYRRKIRAPGSAHSQGLESLSKHHMPADVVTIIGTQDIVFGEVDR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000460 [exp]	0	1
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10000459 [exp]	1.4	0.9984
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10009720 [exp]	2.0	0.9984
ATMG00080		ATMG00080.1, RP...	ribosomal protein L16 (.1)		Lus10004083 [exp]	2.4	0.9853
ATMG00510		ATMG00510.1, NA...	NADH dehydrogenase subunit 7 (...		Lus10015033 [exp]	2.4	0.9961
ATMG01360		ATMG01360.1, CO...	cytochrome oxidase (.1)		Lus10004084 [exp]	3.5	0.9929
ATMG01360		ATMG01360.1, CO...	cytochrome oxidase (.1)		Lus10009204 [exp]	3.9	0.9900
ATMG00650		ATMG00650.1, NA...	NADH dehydrogenase subunit 4L ...		Lus10004838 [exp]	4.6	0.9839
AT2G07675			Ribosomal protein S12/S23 fami...		Lus10002330 [exp]	4.9	0.9756
					Lus10007204 [exp]	8.5	0.9597
AT3G52250	MYB		Duplicated homeodomain-like su...		Lus10041413 [exp]	9.6	0.9470

Compare expression of checked genes

Lus10000460 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.