Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31083 40 / 1e-05 AtCLE5, CLE5, CLE7 CLAVATA3/ESR-RELATED 5 (.1) AT2G31085 37 / 0.0002 AtCLE6, CLE6 CLAVATA3/ESR-RELATED 6 (.1) AT2G31082 35 / 0.0006 CLE7, CLE5 CLAVATA3/ESR-RELATED 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002196 [exp] 132 / 7e-42 AT2G31083 49 / 8e-09 CLAVATA3/ESR-RELATED 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G090800 [exp] 48 / 1e-08 AT2G31083 60 / 1e-13 CLAVATA3/ESR-RELATED 5 (.1) Potri.011G096900 [exp] 42 / 2e-06 AT2G31083 49 / 4e-09 CLAVATA3/ESR-RELATED 5 (.1) Potri.001G376200 [exp] 41 / 5e-06 AT2G31083 54 / 4e-11 CLAVATA3/ESR-RELATED 5 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000464 pacid=23165449 polypeptide=Lus10000464 locus=Lus10000464.g ID=Lus10000464.BGIv1.0 annot-version=v1.0 ATGGCTGCCACTAACCAAAAAGGAAACGTGATGATACTACTAATAGTGGCCTCAGTCCTCATCTGCAGCTCACATGCTGCTCGCATTAATCTAAAGGTGC ATGAGCATGAGGAGGCGGTGGCCGTGGGTCTGACAGCTGATCATCATCAAGATAGCAGCAGCCGGAGTAGGAGTCTGCTGAGGGAGTTGGGTTATGATGA CTCCAAACTGAAGCAATACAAGAAGATCGCTTCTGATAGGGTTGCACCTGGAGGACCTGATCCTCATCATCATTAA
AA sequence Show only first row Show all	>Lus10000464 pacid=23165449 polypeptide=Lus10000464 locus=Lus10000464.g ID=Lus10000464.BGIv1.0 annot-version=v1.0 MAATNQKGNVMILLIVASVLICSSHAARINLKVHEHEEAVAVGLTADHHQDSSSRSRSLLRELGYDDSKLKQYKKIASDRVAPGGPDPHHH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31085		AtCLE6, CLE6	CLAVATA3/ESR-RELATED 6 (.1)		Lus10000464 [exp]	0	1
AT1G71250			GDSL-like Lipase/Acylhydrolase...		Lus10039152 [exp]	2.4	0.7596
AT1G14185			Glucose-methanol-choline (GMC)...		Lus10012818 [exp]	13.0	0.7277
AT2G38290		AMT2;1, ATAMT2	AMMONIUM TRANSPORTER 2;1, ammo...		Lus10009928 [exp]	33.7	0.6620
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10033877 [exp]	38.2	0.6526
					Lus10019746 [exp]	49.3	0.6323
AT3G07870			F-box and associated interacti...		Lus10012358 [exp]	57.1	0.7036
AT3G59800			unknown protein		Lus10027089 [exp]	72.3	0.6076
AT1G13710		CYP78A5, KLUH	KLUH, "cytochrome P450, family...		Lus10015788 [exp]	84.1	0.6295
AT3G24310	MYB	MYB305, ATMYB71	MYB DOMAIN PROTEIN 71, myb dom...		Lus10023711 [exp]	86.9	0.6737
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10027430 [exp]	89.6	0.6100

Compare expression of checked genes

Lus10000464 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.