Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G25830 46 / 3e-07 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) AT3G25820 46 / 3e-07 ATTPS-CIN "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1.2) AT3G25810 45 / 6e-07 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT1G61680 44 / 2e-06 ATTPS14 terpene synthase 14 (.1.2) AT2G24210 43 / 6e-06 AtTPS10 terpene synthase 10 (.1) AT4G16730 42 / 1e-05 AtTPS02 terpene synthase 02 (.1) AT1G70080 41 / 2e-05 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT3G29110 41 / 3e-05 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) AT4G16740 40 / 8e-05 ATTPS03 terpene synthase 03 (.1.2) AT5G48110 38 / 0.0003 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031590 [exp] 80 / 5e-19 AT5G23960 378 / 3e-125 terpene synthase 21 (.1.2) Lus10031589 [exp] 64 / 2e-13 AT5G23960 318 / 3e-101 terpene synthase 21 (.1.2) Lus10002660 [exp] 58 / 3e-11 AT3G14520 310 / 4e-98 Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10034232 [exp] 46 / 4e-07 AT1G79460 569 / 0.0 GA REQUIRING 2, ARABIDOPSIS THALIANA ENT-KAURENE SYNTHASE 1, ARABIDOPSIS THALIANA ENT-KAURENE SYNTHASE, Terpenoid cyclases/Protein prenyltransferases superfamily protein (.1) Lus10008611 [exp] 45 / 1e-06 AT5G23960 348 / 4e-113 terpene synthase 21 (.1.2) Lus10042204 [exp] 44 / 2e-06 AT5G23960 347 / 4e-113 terpene synthase 21 (.1.2) Lus10040043 [exp] 44 / 2e-06 AT5G23960 329 / 7e-106 terpene synthase 21 (.1.2) Lus10014724 [exp] 44 / 3e-06 AT5G23960 314 / 2e-100 terpene synthase 21 (.1.2) Lus10042202 [exp] 43 / 5e-06 AT5G23960 302 / 8e-96 terpene synthase 21 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G016900 [exp] 50 / 2e-08 AT5G23960 474 / 6e-163 terpene synthase 21 (.1.2) Potri.005G095500 [exp] 50 / 2e-08 AT5G23960 408 / 6e-137 terpene synthase 21 (.1.2) Potri.011G142800 [exp] 49 / 3e-08 AT5G23960 405 / 2e-135 terpene synthase 21 (.1.2) Potri.011G032300 [exp] 48 / 9e-08 AT1G61680 350 / 1e-115 terpene synthase 14 (.1.2) Potri.015G085500 [exp] 46 / 3e-07 AT5G23960 456 / 1e-155 terpene synthase 21 (.1.2) Potri.019G022338 [exp] 46 / 3e-07 AT3G25830 483 / 8e-165 "terpene synthase-like sequence-1,8-cineole", terpene synthase-like sequence-1,8-cineole (.1) Potri.019G045100 [exp] 46 / 5e-07 AT5G23960 474 / 2e-162 terpene synthase 21 (.1.2) Potri.007G074466 [exp] 45 / 8e-07 AT5G23960 443 / 1e-150 terpene synthase 21 (.1.2) Potri.007G074400 [exp] 45 / 1e-06 AT5G23960 441 / 6e-150 terpene synthase 21 (.1.2) Potri.019G023016 [exp] 44 / 2e-06 AT5G23960 335 / 1e-109 terpene synthase 21 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0613 [flax] [poplar] Terp_synthase PF03936 [flax] [poplar] Terpene_synth_C Terpene synthase family, metal binding domain
Representative CDS sequence Show only first row Show all	>Lus10000476 pacid=23174333 polypeptide=Lus10000476 locus=Lus10000476.g ID=Lus10000476.BGIv1.0 annot-version=v1.0 ATGTCTGTGTACCAGCAAGATGAGATGCACAGTGAAGCTATTATGAAGTTGGGGAAGCTGGATTTCAACTTGCGTCAGAATTTGCATCAACAGGAGCTCA ATATTCTCACCAAGCTCTTCTGCATGGATCATGCAAAGGACGCAGTGAAACGGTTAACGAGGGCTTACATTACTGAAGCAAGATGGTACAACAAAGGCAA TGTGCCAAGCATTGAAGAATATTTGCCTAATGGGTATGTAAGCGTTGGATATCCGCTTGGAATCACACTATAA
AA sequence Show only first row Show all	>Lus10000476 pacid=23174333 polypeptide=Lus10000476 locus=Lus10000476.g ID=Lus10000476.BGIv1.0 annot-version=v1.0 MSVYQQDEMHSEAIMKLGKLDFNLRQNLHQQELNILTKLFCMDHAKDAVKRLTRAYITEARWYNKGNVPSIEEYLPNGYVSVGYPLGITL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G25820		ATTPS-CIN	"terpene synthase-like sequenc...		Lus10000476 [exp]	0	1
AT4G37790	HD	HAT22	Homeobox-leucine zipper protei...		Lus10027633 [exp]	2.8	0.7408
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10000168 [exp]	13.0	0.6575
ATCG00900		ATCG00900.1, RP...	CHLOROPLAST RIBOSOMAL PROTEIN ...		Lus10002395 [exp]	14.3	0.6575
AT4G08570			Heavy metal transport/detoxifi...		Lus10039419 [exp]	18.5	0.6928
AT2G46300			Late embryogenesis abundant (L...		Lus10010130 [exp]	19.1	0.6702
AT2G25409			unknown protein		Lus10010124 [exp]	19.4	0.5691
					Lus10017557 [exp]	20.1	0.6860
AT3G28470	MYB	TDF1, ATMYB35	DEFECTIVE IN MERISTEM DEVELOPM...		Lus10005834 [exp]	33.4	0.6368
AT3G18180			Glycosyltransferase family 61 ...		Lus10032457 [exp]	35.0	0.6135
AT5G26594		ARR24	response regulator 24 (.1)		Lus10005407 [exp]	38.2	0.6479

Compare expression of checked genes

Lus10000476 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.