Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G12060 84 / 6e-22 Plant self-incompatibility protein S1 family (.1) AT1G04645 77 / 2e-19 Plant self-incompatibility protein S1 family (.1) AT5G12070 74 / 2e-18 Plant self-incompatibility protein S1 family (.1) AT3G17080 71 / 3e-17 Plant self-incompatibility protein S1 family (.1) AT4G16195 70 / 2e-16 Plant self-incompatibility protein S1 family (.1) AT3G16970 68 / 6e-16 Plant self-incompatibility protein S1 family (.1) AT4G24973 63 / 5e-14 Plant self-incompatibility protein S1 family (.1) AT4G24975 62 / 8e-14 Plant self-incompatibility protein S1 family (.1) AT4G24974 61 / 3e-13 Plant self-incompatibility protein S1 family (.1) AT1G26799 54 / 2e-10 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030964 [exp] 135 / 2e-42 AT5G12060 102 / 2e-28 Plant self-incompatibility protein S1 family (.1) Lus10030965 [exp] 130 / 2e-40 AT3G16970 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10011068 [exp] 123 / 1e-37 AT4G16195 103 / 5e-29 Plant self-incompatibility protein S1 family (.1) Lus10011069 [exp] 89 / 8e-24 AT4G16195 89 / 2e-23 Plant self-incompatibility protein S1 family (.1) Lus10008107 [exp] 88 / 1e-23 AT4G16195 98 / 1e-26 Plant self-incompatibility protein S1 family (.1) Lus10013145 [exp] 80 / 2e-20 AT4G16195 88 / 8e-23 Plant self-incompatibility protein S1 family (.1) Lus10030565 [exp] 77 / 3e-19 AT3G16970 91 / 7e-24 Plant self-incompatibility protein S1 family (.1) Lus10011753 [exp] 63 / 2e-13 AT3G16970 90 / 1e-22 Plant self-incompatibility protein S1 family (.1) Lus10017929 [exp] 40 / 2e-05 AT4G16195 71 / 1e-16 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G148700 [exp] 69 / 3e-16 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 65 / 2e-14 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.010G008300 [exp] 63 / 4e-14 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 60 / 6e-13 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.017G144361 [exp] 59 / 2e-12 AT4G24975 110 / 1e-31 Plant self-incompatibility protein S1 family (.1) Potri.016G066900 [exp] 41 / 2e-05 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.003G175200 [exp] 40 / 3e-05 AT3G24060 177 / 2e-58 Plant self-incompatibility protein S1 family (.1) Potri.015G130300 [exp] 36 / 0.0009 AT3G17080 52 / 3e-09 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10000480 pacid=23142782 polypeptide=Lus10000480 locus=Lus10000480.g ID=Lus10000480.BGIv1.0 annot-version=v1.0 ATGATGCACTGCAAGTCGAAGCAAGACGGTCTGGGGAAGAAAGTGGTACCAAAGTGGCAATCTTGGGGGTGGCATTTCACCCCGAATGCATGGGGAACAA CTCAGTTGTACTGCGCGTTCGACTGGGAAGGGAACGACGAAGGGTGGAAGTGTTTCGACATCTACGTAGAGAAGAGGGATCAGCTTCACTGCTTCGACTG TAAATGGGTTGTAACTCAGAGGGGCCCTTGCCGGTATGATGAGGAGAAGAATTCTTATAATATTTGCTATGATTGGAACAAGTAG
AA sequence Show only first row Show all	>Lus10000480 pacid=23142782 polypeptide=Lus10000480 locus=Lus10000480.g ID=Lus10000480.BGIv1.0 annot-version=v1.0 MMHCKSKQDGLGKKVVPKWQSWGWHFTPNAWGTTQLYCAFDWEGNDEGWKCFDIYVEKRDQLHCFDCKWVVTQRGPCRYDEEKNSYNICYDWNK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G12060			Plant self-incompatibility pro...		Lus10000480 [exp]	0	1

Compare expression of checked genes

Lus10000480 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.