Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15802 52 / 5e-10 AtHSBP Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G208100 [exp] 56 / 2e-11 AT4G15802 123 / 3e-38 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1) Potri.010G025000 [exp] 53 / 2e-10 AT4G15802 114 / 8e-35 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1) Potri.014G131701 [exp] 49 / 1e-08 AT4G15802 120 / 3e-37 Arabidopsis thaliana heat shock factor binding protein, heat shock factor binding protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000501 pacid=23174703 polypeptide=Lus10000501 locus=Lus10000501.g ID=Lus10000501.BGIv1.0 annot-version=v1.0 ATGAATTGTGATGGCAAGAGATCAAATGTTCGTTCGACGTCTGTTGAATCAGCTGCTTACGATCTGTTCTTGGAGGTTTCTGCAGTTGCAGCAGTTTATT GCCTGTCGCGATTTCAGTCTGTAGGTAGTCAGGGTTTTTGTATCGTTTATCTAGCTCACCGAGTAGGGAACCTACGCTTGATTTTCTTGGGTTGGACGAT TGCTGAAGATGGACACGATGGTGATGATGTGAAGCAGAGCACTGCTGATATGACTGCTTTTGTTCAAAACCTGCTTCAGCAGATGGTAAGCTTTGGTCGG TCTGTGTATTTTGGGATTTCTGTACTGAATCCTTGTTCTAAGCGTTAG
AA sequence Show only first row Show all	>Lus10000501 pacid=23174703 polypeptide=Lus10000501 locus=Lus10000501.g ID=Lus10000501.BGIv1.0 annot-version=v1.0 MNCDGKRSNVRSTSVESAAYDLFLEVSAVAAVYCLSRFQSVGSQGFCIVYLAHRVGNLRLIFLGWTIAEDGHDGDDVKQSTADMTAFVQNLLQQMVSFGR SVYFGISVLNPCSKR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15802		AtHSBP	Arabidopsis thaliana heat shoc...		Lus10000501 [exp]	0	1
AT5G20320		DCL4, ATDCL4	dicer-like 4 (.1.2)		Lus10019588 [exp]	9.3	0.9007
AT1G58250		SAB	SABRE, Golgi-body localisation...		Lus10024283 [exp]	11.1	0.9161
AT3G63460		EMB2221	transducin family protein / WD...		Lus10016374 [exp]	19.7	0.9004
AT1G55350		EMB80, ATDEK1, ...	EMBRYO DEFECTIVE 80, embryo de...		Lus10010314 [exp]	24.2	0.8933
AT2G07675			Ribosomal protein S12/S23 fami...		Lus10002330 [exp]	32.4	0.8887
AT2G35630		GEM1, MOR1	MICROTUBULE ORGANIZATION 1, AR...		Lus10001216 [exp]	32.6	0.8922
AT5G15680			ARM repeat superfamily protein...		Lus10035142 [exp]	33.2	0.8903
AT5G20930		TSL	TOUSLED, Protein kinase superf...		Lus10036171 [exp]	37.4	0.8845
					Lus10002716 [exp]	39.5	0.8570
AT1G55325		MAB2, GCT	MACCHI-BOU 2, GRAND CENTRAL, R...		Lus10035973 [exp]	41.1	0.8892

Compare expression of checked genes

Lus10000501 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.