Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G15800 127 / 5e-39 RALFL33 ralf-like 33 (.1) AT3G16570 110 / 3e-32 ATRALF23, RALFL23 ARABIDOPSIS RAPID ALKALINIZATION FACTOR 23, rapid alkalinization factor 23 (.1) AT1G02900 109 / 5e-32 RALF1, RALFL1, ATRALF1 RALF-LIKE 1, rapid alkalinization factor 1 (.1) AT3G05490 97 / 6e-27 RALFL22 ralf-like 22 (.1) AT2G33775 87 / 4e-23 RALFL19 ralf-like 19 (.1) AT1G28270 81 / 7e-21 RALFL4 ralf-like 4 (.1) AT4G13950 77 / 3e-19 RALFL31 ralf-like 31 (.1) AT3G23805 66 / 1e-14 RALFL24 ralf-like 24 (.1) AT5G67070 60 / 2e-12 RALFL34 ralf-like 34 (.1) AT4G14010 59 / 3e-12 RALFL32 ralf-like 32 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037512 [exp] 177 / 8e-59 AT4G15800 131 / 9e-41 ralf-like 33 (.1) Lus10029893 [exp] 112 / 7e-33 AT4G15800 116 / 8e-35 ralf-like 33 (.1) Lus10020647 [exp] 104 / 7e-30 AT4G15800 119 / 5e-36 ralf-like 33 (.1) Lus10015172 [exp] 98 / 1e-27 AT4G15800 107 / 2e-31 ralf-like 33 (.1) Lus10015316 [exp] 72 / 4e-17 AT1G28270 100 / 7e-29 ralf-like 4 (.1) Lus10025444 [exp] 71 / 6e-17 AT1G28270 100 / 2e-28 ralf-like 4 (.1) Lus10005541 [exp] 64 / 3e-14 AT1G28270 69 / 3e-16 ralf-like 4 (.1) Lus10016646 [exp] 64 / 5e-14 AT4G13950 100 / 1e-28 ralf-like 31 (.1) Lus10022561 [exp] 63 / 7e-14 AT4G13950 100 / 1e-28 ralf-like 31 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G208200 [exp] 138 / 2e-43 AT4G15800 132 / 2e-41 ralf-like 33 (.1) Potri.013G017400 [exp] 116 / 1e-34 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.005G025800 [exp] 115 / 2e-34 AT4G15800 138 / 1e-43 ralf-like 33 (.1) Potri.014G131800 [exp] 106 / 1e-30 AT4G15800 123 / 1e-37 ralf-like 33 (.1) Potri.004G044900 [exp] 88 / 1e-23 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.004G045000 [exp] 88 / 2e-23 AT1G28270 103 / 4e-30 ralf-like 4 (.1) Potri.017G059500 [exp] 75 / 4e-18 AT4G13950 96 / 2e-26 ralf-like 31 (.1) Potri.001G320700 [exp] 62 / 2e-13 AT3G23805 96 / 1e-26 ralf-like 24 (.1) Potri.005G139100 [exp] 62 / 2e-13 AT5G67070 118 / 4e-35 ralf-like 34 (.1) Potri.007G044700 [exp] 57 / 2e-11 AT5G67070 119 / 1e-35 ralf-like 34 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05498 [flax] [poplar] RALF Rapid ALkalinization Factor (RALF)
Representative CDS sequence Show only first row Show all	>Lus10000502 pacid=23174699 polypeptide=Lus10000502 locus=Lus10000502.g ID=Lus10000502.BGIv1.0 annot-version=v1.0 ATGGGAAGAAGCCAGCTGAGAGGACTCCTCCTAATTTGCACAATCCTATTGCTACAGCTGGCCGTATCGACATCAACAGCCATCGATTTCCTCCCTGTGA AGTCCGGCGGTGGAGGATGCAACGGATCCATCGCCGAGTGTATGATGACGACGATGATCGACGGCGAGGGAGACGACGAGGAGTTCGCCATGGAGTCGGA GAGCGCCAGGCGCATTTTAGCGTCTAGAAGGTACATAAGCTACGGAGCACTGAGGAGGAACAGCGTGCCGTGCTCGAGGCGAGGCGCCTCCTACTACAAT TGCCGCGGCGGGGCTCGGGCCAATCCCTATACCCGCGGCTGCTCCCGCATAACTCGCTGCCGCTACTGA
AA sequence Show only first row Show all	>Lus10000502 pacid=23174699 polypeptide=Lus10000502 locus=Lus10000502.g ID=Lus10000502.BGIv1.0 annot-version=v1.0 MGRSQLRGLLLICTILLLQLAVSTSTAIDFLPVKSGGGGCNGSIAECMMTTMIDGEGDDEEFAMESESARRILASRRYISYGALRRNSVPCSRRGASYYN CRGGARANPYTRGCSRITRCRY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G15800		RALFL33	ralf-like 33 (.1)		Lus10000502 [exp]	0	1
					Lus10016420 [exp]	1.0	0.9736
					Lus10037463 [exp]	1.7	0.9235
AT1G75620			glyoxal oxidase-related protei...		Lus10024312 [exp]	2.0	0.9546
AT1G73880		UGT89B1	UDP-glucosyl transferase 89B1 ...		Lus10021719 [exp]	2.2	0.9147
AT1G33760	AP2_ERF		Integrase-type DNA-binding sup...		Lus10041052 [exp]	3.0	0.8996
AT3G13130			unknown protein		Lus10039066 [exp]	3.6	0.8894
AT5G24030		SLAH3	SLAC1 homologue 3 (.1)		Lus10039312 [exp]	3.7	0.9029
AT1G06520		ATGPAT1, GPAT1	glycerol-3-phosphate acyltrans...		Lus10000072 [exp]	4.5	0.9218
AT1G19900			glyoxal oxidase-related protei...		Lus10012387 [exp]	6.0	0.8901
AT4G01950		ATGPAT3, GPAT3	glycerol-3-phosphate acyltrans...		Lus10029839 [exp]	6.3	0.9011

Compare expression of checked genes

Lus10000502 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.