Lus10000520 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G44920 285 / 2e-98 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
AT1G12250 65 / 9e-13 Pentapeptide repeat-containing protein (.1.2)
AT5G55000 59 / 2e-10 FIP2 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002712 348 / 1e-123 AT2G44920 287 / 3e-99 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Lus10024602 60 / 1e-10 AT1G12250 354 / 1e-123 Pentapeptide repeat-containing protein (.1.2)
Lus10032239 60 / 1e-10 AT1G12250 357 / 9e-125 Pentapeptide repeat-containing protein (.1.2)
Lus10020270 51 / 2e-07 AT5G55000 430 / 2e-149 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10002622 49 / 7e-07 AT5G55000 462 / 1e-165 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Lus10007788 42 / 9e-05 AT5G53490 301 / 2e-104 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G200000 309 / 4e-108 AT2G44920 256 / 4e-87 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.008G058800 306 / 5e-107 AT2G44920 253 / 1e-85 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2)
Potri.003G112900 66 / 1e-12 AT1G12250 363 / 1e-128 Pentapeptide repeat-containing protein (.1.2)
Potri.013G062500 50 / 3e-07 AT5G55000 413 / 2e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Potri.019G038400 49 / 1e-06 AT5G55000 414 / 1e-146 potassium channel tetramerisation domain-containing protein / pentapeptide repeat-containing protein (.1.2)
Potri.012G018100 42 / 9e-05 AT5G53490 318 / 1e-110 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2), Tetratricopeptide repeat (TPR)-like superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0505 Pentapeptide PF00805 Pentapeptide Pentapeptide repeats (8 copies)
Representative CDS sequence
>Lus10000520 pacid=23158771 polypeptide=Lus10000520 locus=Lus10000520.g ID=Lus10000520.BGIv1.0 annot-version=v1.0
ATGCATCTTCTTCTGAATGTATCGCTCTGTACGGCTAAAACTCCACCAAAACCCTCACTTCCATTCCTTCCAAACCCTCCACAACCCCCACTTTCTCTTT
CTTTGCCCCGTTCCCAGGTGTTACGAGACTTGGCTAAAACAGGCTTGCTTGCAATGCTATCCGCCTCTGTCTTCCTCGCTGACCCTGCTCTCGCATACAA
GGGAGGAGGTCCGTACGGTTCTGAGGTGACCAGGGGCCAGGATCTGACTGGCAAGGATTTCAGTGGCAAGACTTTGATCAAGCAGGACTTTAAGACGTCA
ATTCTAAGGCAAGCCAATTTCAAAGGTGCAAAGTTGCTCGGGGCTAGTTTCTTTGATGCTGATTTGACTGGAGCCGATCTTTCGGATGCAGACCTTAGAG
GAGTAGATTTCTCATTGGCCAATGTGACAAAGGTGAACTTGAGCAATGCCAACCTAGAAGGCGCTCTAACCACAGGCAATACTTCATTCAAGGGCTCAAA
CATAGCAGGAGCAGATTTCACTGATGTGCCTCTACGGGAGGATCAGCGTGAATACCTTTGCAAAATTGCAGATGGGGTGAACCCAACTACCGGAAATGCG
ACCCGTGAGACTTTACTTTGTAACTAA
AA sequence
>Lus10000520 pacid=23158771 polypeptide=Lus10000520 locus=Lus10000520.g ID=Lus10000520.BGIv1.0 annot-version=v1.0
MHLLLNVSLCTAKTPPKPSLPFLPNPPQPPLSLSLPRSQVLRDLAKTGLLAMLSASVFLADPALAYKGGGPYGSEVTRGQDLTGKDFSGKTLIKQDFKTS
ILRQANFKGAKLLGASFFDADLTGADLSDADLRGVDFSLANVTKVNLSNANLEGALTTGNTSFKGSNIAGADFTDVPLREDQREYLCKIADGVNPTTGNA
TRETLLCN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10000520 0 1
AT4G19100 PAM68 photosynthesis affected mutant... Lus10012152 1.0 0.9639
AT1G79850 PDE347, CS17, P... PLASTID RIBOSOMAL SMALL SUBUNI... Lus10025799 5.7 0.9613
AT2G44920 Tetratricopeptide repeat (TPR)... Lus10002712 6.9 0.9432
AT5G65220 Ribosomal L29 family protein ... Lus10019653 8.0 0.9564
AT5G14320 EMB3137 EMBRYO DEFECTIVE 3137, Ribosom... Lus10025642 8.7 0.9588
AT2G35500 SKL2 shikimate kinase-like 2, shiki... Lus10035389 9.6 0.9338
AT3G15190 chloroplast 30S ribosomal prot... Lus10005538 10.4 0.9451
AT3G14110 FLU FLUORESCENT IN BLUE LIGHT, Tet... Lus10008131 12.0 0.9438
AT3G26900 ATSKL1 Arabidopsis thaliana shikimate... Lus10035171 12.7 0.9370
AT1G75350 EMB2184 embryo defective 2184, Ribosom... Lus10033200 14.1 0.9544

Lus10000520 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.