Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G27360 101 / 2e-26 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G28610 94 / 7e-24 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G28600 91 / 3e-23 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G28590 91 / 1e-22 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G31550 88 / 1e-21 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G28570 87 / 1e-21 SGNH hydrolase-type esterase superfamily protein (.1.2) AT1G28640 85 / 1e-20 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G28580 84 / 2e-20 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) AT1G28670 81 / 7e-19 ARAB-1 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) AT1G28660 80 / 1e-18 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013938 [exp] 134 / 5e-39 AT1G28590 367 / 2e-125 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10000523 [exp] 133 / 1e-38 AT1G28590 363 / 6e-124 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Lus10015477 [exp] 100 / 5e-26 AT1G28600 239 / 5e-74 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Lus10019947 [exp] 98 / 1e-25 AT1G28580 300 / 5e-101 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Lus10015476 [exp] 95 / 6e-24 AT1G28600 315 / 5e-103 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Lus10024085 [exp] 94 / 1e-23 AT1G31550 321 / 3e-107 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Lus10010208 [exp] 93 / 1e-23 AT1G28610 267 / 1e-86 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Lus10003516 [exp] 51 / 1e-08 AT5G03980 103 / 6e-26 SGNH hydrolase-type esterase superfamily protein (.1) Lus10009325 [exp] 50 / 2e-08 AT5G03980 80 / 3e-17 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G054300 [exp] 89 / 4e-22 AT1G28590 388 / 1e-133 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.011G064100 [exp] 86 / 7e-22 AT1G28580 221 / 5e-72 GDSL-like Lipase/Acylhydrolase superfamily protein (.1.2) Potri.004G054400 [exp] 84 / 3e-20 AT5G45910 377 / 8e-130 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.001G463900 [exp] 58 / 7e-11 AT1G28650 228 / 3e-71 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G024900 [exp] 56 / 3e-10 AT5G03980 273 / 1e-89 SGNH hydrolase-type esterase superfamily protein (.1) Potri.013G015200 [exp] 56 / 5e-10 AT1G28590 213 / 3e-65 GDSL-like Lipase/Acylhydrolase superfamily protein (.1) Potri.005G025000 [exp] 52 / 1e-08 AT5G03980 270 / 1e-88 SGNH hydrolase-type esterase superfamily protein (.1) Potri.005G024966 [exp] 52 / 1e-08 AT5G03980 270 / 1e-88 SGNH hydrolase-type esterase superfamily protein (.1) Potri.005G024933 [exp] 51 / 2e-08 AT5G03980 255 / 1e-82 SGNH hydrolase-type esterase superfamily protein (.1) Potri.005G024300 [exp] 50 / 3e-08 AT5G03980 275 / 1e-90 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000524 pacid=23164430 polypeptide=Lus10000524 locus=Lus10000524.g ID=Lus10000524.BGIv1.0 annot-version=v1.0 ATGAGCCAAATCATGTATTATCCGAATCTTTTCCAGGAGTTGGTTGTATTTGGGGCAGTGACGATTTTGGTTCCCGAGAATCCGCCCATCGGATGCATGG TGGATTCCCTTACGAAATTCTCGAGCCCCAACGAGGAAGATTACGAGCCTCAGAGCGGGTGTCCCATTTGGTTCAACGATTTTGCTAAGCATCACAACAA CCTTCTAGAGAAGGAAATTATTCGGCTTAGGGAGATTCATCCTCATACCAACATTATGTACGACAACTATTATGGATCCCTCATTCGACTCCATCGACAC CCTGAAAATTCGGTTGCACCGGGTCGGGCGTGGTCAGGGACGTATCTAGAATAG
AA sequence Show only first row Show all	>Lus10000524 pacid=23164430 polypeptide=Lus10000524 locus=Lus10000524.g ID=Lus10000524.BGIv1.0 annot-version=v1.0 MSQIMYYPNLFQELVVFGAVTILVPENPPIGCMVDSLTKFSSPNEEDYEPQSGCPIWFNDFAKHHNNLLEKEIIRLREIHPHTNIMYDNYYGSLIRLHRH PENSVAPGRAWSGTYLE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G27360			GDSL-like Lipase/Acylhydrolase...		Lus10000524 [exp]	0	1

Compare expression of checked genes

Lus10000524 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.