Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009731 [exp] 126 / 2e-39 ND /
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G194100 [exp] 74 / 1e-18 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000527 pacid=23180210 polypeptide=Lus10000527 locus=Lus10000527.g ID=Lus10000527.BGIv1.0 annot-version=v1.0 ATGTCTATTAACAAGCAGAGGAGCCTCTCTACCCACAGTGCCAAGCGCATCAGGTTTGGCAAGTGGTTTTCTTTCAAGGAGGTGCCGATGGAACCTGGGA AGTCGTTGAAGCAGCAGAATTCTGGGAAGTTGAAAGCTGATATCAAGAGATGGGCCAAAGCTGTGGCAGCTTATGCCTGCCAACTCAGTGGCCGACTTGG AAATTCGATCCGGAGCAGCATGATCAGAAGCTCCTCCTGCCATTCTTCTACTTATTCTTCTTCATCGACGCCATCAGTATGA
AA sequence Show only first row Show all	>Lus10000527 pacid=23180210 polypeptide=Lus10000527 locus=Lus10000527.g ID=Lus10000527.BGIv1.0 annot-version=v1.0 MSINKQRSLSTHSAKRIRFGKWFSFKEVPMEPGKSLKQQNSGKLKADIKRWAKAVAAYACQLSGRLGNSIRSSMIRSSSCHSSTYSSSSTPSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10000527 [exp]	0	1
AT3G22370		AtHSR3, ATAOX1A...	hyper-sensitivity-related 3, a...		Lus10035670 [exp]	2.0	0.9861
AT1G55230			Family of unknown function (DU...		Lus10013749 [exp]	3.5	0.9812
AT1G17860			Kunitz family trypsin and prot...		Lus10007902 [exp]	5.5	0.9812
AT1G14550			Peroxidase superfamily protein...		Lus10024205 [exp]	5.9	0.9779
AT3G05950			RmlC-like cupins superfamily p...		Lus10032017 [exp]	7.5	0.9751
AT2G18620			Terpenoid synthases superfamil...		Lus10009136 [exp]	7.7	0.9812
AT1G10740			alpha/beta-Hydrolases superfam...		Lus10013048 [exp]	8.8	0.9757
AT2G14095			unknown protein		Lus10001300 [exp]	9.7	0.9743
AT2G43840		UGT74F1	UDP-glycosyltransferase 74 F1 ...		Lus10008742 [exp]	10.7	0.9781
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10006552 [exp]	11.0	0.9738

Compare expression of checked genes

Lus10000527 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.