Lus10000534 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16480 188 / 1e-57 ATINT4 inositol transporter 4 (.1)
AT2G35740 185 / 3e-56 ATINT3 nositol transporter 3 (.1)
AT1G30220 162 / 9e-48 ATINT2 ARABIDOPSIS THALIANA INOSITOL TRANSPORTER 2, inositol transporter 2 (.1)
AT2G43330 115 / 2e-30 ATINT1 inositol transporter 1 (.1)
AT2G18480 81 / 2e-18 AtPLT3 Major facilitator superfamily protein (.1)
AT4G36670 79 / 1e-17 AtPMT6, AtPLT6 polyol/monosaccharide transporter 6, polyol transporter 6, Major facilitator superfamily protein (.1)
AT2G20780 76 / 2e-16 AtPLT4 Major facilitator superfamily protein (.1)
AT3G05150 75 / 2e-16 Major facilitator superfamily protein (.1)
AT2G48020 74 / 8e-16 Major facilitator superfamily protein (.1.2)
AT1G08930 72 / 3e-15 ERD6 EARLY RESPONSE TO DEHYDRATION 6, Major facilitator superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039050 240 / 3e-77 AT4G16480 769 / 0.0 inositol transporter 4 (.1)
Lus10010501 234 / 4e-75 AT4G16480 755 / 0.0 inositol transporter 4 (.1)
Lus10017559 230 / 7e-74 AT2G35740 669 / 0.0 nositol transporter 3 (.1)
Lus10038808 213 / 9e-67 AT4G16480 760 / 0.0 inositol transporter 4 (.1)
Lus10017561 200 / 6e-62 AT4G16480 820 / 0.0 inositol transporter 4 (.1)
Lus10010500 196 / 3e-60 AT4G16480 823 / 0.0 inositol transporter 4 (.1)
Lus10028118 167 / 1e-49 AT1G30220 893 / 0.0 ARABIDOPSIS THALIANA INOSITOL TRANSPORTER 2, inositol transporter 2 (.1)
Lus10042820 167 / 1e-49 AT1G30220 890 / 0.0 ARABIDOPSIS THALIANA INOSITOL TRANSPORTER 2, inositol transporter 2 (.1)
Lus10027026 100 / 2e-25 AT2G43330 769 / 0.0 inositol transporter 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G015300 224 / 2e-71 AT4G16480 788 / 0.0 inositol transporter 4 (.1)
Potri.006G015200 209 / 3e-65 AT4G16480 811 / 0.0 inositol transporter 4 (.1)
Potri.016G010600 208 / 5e-65 AT4G16480 825 / 0.0 inositol transporter 4 (.1)
Potri.004G133420 117 / 2e-33 AT1G30220 328 / 2e-110 ARABIDOPSIS THALIANA INOSITOL TRANSPORTER 2, inositol transporter 2 (.1)
Potri.017G032400 109 / 1e-30 AT2G43330 272 / 8e-90 inositol transporter 1 (.1)
Potri.017G032200 113 / 7e-30 AT2G43330 743 / 0.0 inositol transporter 1 (.1)
Potri.007G126800 104 / 1e-26 AT2G43330 710 / 0.0 inositol transporter 1 (.1)
Potri.013G135200 81 / 3e-18 AT2G20780 747 / 0.0 Major facilitator superfamily protein (.1)
Potri.007G027900 75 / 3e-16 AT4G36670 638 / 0.0 polyol/monosaccharide transporter 6, polyol transporter 6, Major facilitator superfamily protein (.1)
Potri.004G152300 72 / 2e-15 AT3G18830 625 / 0.0 ARABIDOPSIS THALIANA POLYOL/MONOSACCHARIDE TRANSPORTER 5, POLYOL TRANSPORTER 5, polyol/monosaccharide transporter 5 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0015 MFS PF00083 Sugar_tr Sugar (and other) transporter
Representative CDS sequence
>Lus10000534 pacid=23160075 polypeptide=Lus10000534 locus=Lus10000534.g ID=Lus10000534.BGIv1.0 annot-version=v1.0
ATGCTGCTAGCCAGTACAATCCAGGAGCATTGTTTGGTGTCCGACAAGACAGTAAAAGGAGTCTGCCTATCCGAAAAGCGATTATGGTACTCGGAAGGCT
GTCCGAGCAGGATTGGGTTTCTGGCGGTGATTCTTCTTGCTCTGGACATCATTTCCTACTCTCCCGGAATGGGGTCAGCTCCGTGGATCGTCAACTCCGA
GATCTATCCGCTCCGGTACAGAGGGATCGGAGGAGGAATCGCTGCCGTGGCGAACTGGACGTCGAATCTGGTTGTCAGCTTGACGTTTCTGACGATGACC
GAGACCCTGATGGTGGCAGGAGCGTTCCTGATGTTTGCCGGGATTTCGTTGCTGGGTTTGATTGCTATATTCTTTTTGATTCCTGGGACCAAAGGGTTGC
AGTTTGAGGAGGTGGAGAAGATGCTGAAGGATGGGTATAAGCCTGGGCTCTTCAGGAAATCTGAAGCTTGA
AA sequence
>Lus10000534 pacid=23160075 polypeptide=Lus10000534 locus=Lus10000534.g ID=Lus10000534.BGIv1.0 annot-version=v1.0
MLLASTIQEHCLVSDKTVKGVCLSEKRLWYSEGCPSRIGFLAVILLALDIISYSPGMGSAPWIVNSEIYPLRYRGIGGGIAAVANWTSNLVVSLTFLTMT
ETLMVAGAFLMFAGISLLGLIAIFFLIPGTKGLQFEEVEKMLKDGYKPGLFRKSEA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16480 ATINT4 inositol transporter 4 (.1) Lus10000534 0 1
AT2G25930 PYK20, ELF3 EARLY FLOWERING 3, hydroxyprol... Lus10006857 6.8 0.9029
AT2G40740 WRKY ATWRKY55, WRKY5... WRKY DNA-binding protein 55 (.... Lus10029022 8.1 0.7606
AT3G14880 unknown protein Lus10039196 9.2 0.8995
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10015158 12.4 0.8919
AT5G60010 ferric reductase-like transmem... Lus10019390 14.3 0.8919
AT1G04670 unknown protein Lus10004041 16.0 0.8919
Lus10040397 17.5 0.8919
AT4G23350 Protein of Unknown Function (D... Lus10042273 18.6 0.8821
AT3G53690 RING/U-box superfamily protein... Lus10042610 18.9 0.8919
Lus10006918 20.2 0.8919

Lus10000534 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.