Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G41761 93 / 3e-26 unknown protein AT3G55570 79 / 1e-20 unknown protein AT3G09950 77 / 4e-20 unknown protein AT3G11405 61 / 4e-13 unknown protein AT5G55620 57 / 3e-12 unknown protein AT5G06010 56 / 2e-11 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10017552 [exp] 153 / 3e-49 AT5G41761 94 / 2e-25 unknown protein Lus10012634 [exp] 87 / 9e-24 AT5G41761 85 / 6e-23 unknown protein Lus10038794 [exp] 77 / 1e-19 AT3G09950 82 / 6e-22 unknown protein Lus10039065 [exp] 75 / 7e-19 AT3G09950 85 / 6e-23 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G136700 [exp] 105 / 3e-31 AT5G41761 102 / 4e-30 unknown protein Potri.014G095000 [exp] 92 / 7e-26 AT5G41761 97 / 1e-27 unknown protein Potri.014G095100 [exp] 88 / 1e-24 AT5G41761 92 / 3e-26 unknown protein Potri.002G167900 [exp] 88 / 2e-24 AT5G41761 86 / 1e-23 unknown protein Potri.012G031900 [exp] 85 / 2e-23 AT5G41761 88 / 2e-24 unknown protein Potri.006G017700 [exp] 84 / 2e-22 AT5G41761 83 / 6e-22 unknown protein Potri.001G313700 [exp] 78 / 1e-20 AT3G55570 93 / 2e-26 unknown protein Potri.001G313801 [exp] 74 / 2e-18 AT3G55570 85 / 1e-22 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000541 pacid=23160078 polypeptide=Lus10000541 locus=Lus10000541.g ID=Lus10000541.BGIv1.0 annot-version=v1.0 ATGAATGCGATTAAAAGCTTGCTCTCTGGCTCCGCTTTCGGGTACGAATCAAGGAAGACGGATAACAACAGGGGTTCGTCATCAGCATCAACATCAGCAT CAGGATTCAGGATGCCACTGCACTATCCAAGGTTCAAGAAGGAAGACTATGAGAGAATGCCAGAATGGAGAGTTGAGTGCTTGCTGAAAGAATATGGTTT GCCTGTTATTGGAGATGTTCATGAGAAGAGGAAGTTTGCCATGGGAGCTTTTCTTTGGCCTTCTGAGCATTGA
AA sequence Show only first row Show all	>Lus10000541 pacid=23160078 polypeptide=Lus10000541 locus=Lus10000541.g ID=Lus10000541.BGIv1.0 annot-version=v1.0 MNAIKSLLSGSAFGYESRKTDNNRGSSSASTSASGFRMPLHYPRFKKEDYERMPEWRVECLLKEYGLPVIGDVHEKRKFAMGAFLWPSEH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G41761			unknown protein		Lus10000541 [exp]	0	1
AT2G32750			Exostosin family protein (.1)		Lus10010677 [exp]	1.4	0.8625
AT1G08350			Endomembrane protein 70 protei...		Lus10020613 [exp]	8.4	0.8737
AT3G10060			FKBP-like peptidyl-prolyl cis-...		Lus10035560 [exp]	9.5	0.8495
AT2G47770		ATTSPO	TSPO(outer membrane tryptophan...		Lus10010281 [exp]	14.3	0.8482
AT3G02100			UDP-Glycosyltransferase superf...		Lus10003454 [exp]	15.8	0.8182
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10010482 [exp]	19.6	0.8604
AT1G79690		ATNUDT3	nudix hydrolase homolog 3 (.1)		Lus10024090 [exp]	23.6	0.8574
AT3G26740		CCL	CCR-like (.1)		Lus10012569 [exp]	27.5	0.8005
AT3G19760		EIF4A-III	eukaryotic initiation factor 4...		Lus10040975 [exp]	34.6	0.8474
AT2G45550		CYP76C4	"cytochrome P450, family 76, s...		Lus10008935 [exp]	35.2	0.8474

Compare expression of checked genes

Lus10000541 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.