Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [flax] [poplar] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Lus10000542 pacid=23160070 polypeptide=Lus10000542 locus=Lus10000542.g ID=Lus10000542.BGIv1.0 annot-version=v1.0 ATGGCAGTTTCAAGATTGGCCGCCGTGGCTGCAGTTGGTGTCGTCTTGATGTTCGCCATTGCTCTGCCTGCTGCAGCTCAGGCTCCGATCATGGCTCCAG CTCCCGCCCCCGCCGCCACCAGCGACGGGACTTCAATTGACCAAGGGATAGCGTATGTGCTGATGCTGCTGGCTTTGGTTCTGACTTACCTTATTCACGC GGCGGATATGCCTCTCAGTCTCAGCTGCTAA
AA sequence Show only first row Show all	>Lus10000542 pacid=23160070 polypeptide=Lus10000542 locus=Lus10000542.g ID=Lus10000542.BGIv1.0 annot-version=v1.0 MAVSRLAAVAAVGVVLMFAIALPAAAQAPIMAPAPAPAATSDGTSIDQGIAYVLMLLALVLTYLIHAADMPLSLSC

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46330		ATAGP16, AGP16	arabinogalactan protein 16 (.1...		Lus10000542 [exp]	0	1
AT1G66250			O-Glycosyl hydrolases family 1...		Lus10004044 [exp]	2.4	0.9231
AT3G19820		CBB1, EVE1, DW1...	ENHANCED VERY-LOW-FLUENCE RESP...		Lus10010215 [exp]	3.2	0.9070
AT2G29570		ATPCNA2, PCNA2	A. THALIANA PROLIFERATING CELL...		Lus10001197 [exp]	6.5	0.9168
AT5G12080		ATMSL10, MSL10	mechanosensitive channel of sm...		Lus10011953 [exp]	7.3	0.8857
AT1G48480		RKL1	receptor-like kinase 1 (.1)		Lus10031909 [exp]	8.1	0.9069
AT2G15000			unknown protein		Lus10013885 [exp]	11.5	0.9008
AT5G10160			Thioesterase superfamily prote...		Lus10015830 [exp]	11.6	0.9212
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10005883 [exp]	12.3	0.9098
AT3G03960			TCP-1/cpn60 chaperonin family ...		Lus10002625 [exp]	13.5	0.9030
AT3G19820		CBB1, EVE1, DW1...	ENHANCED VERY-LOW-FLUENCE RESP...		Lus10017412 [exp]	14.0	0.8960

Compare expression of checked genes

Lus10000542 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.