Lus10000543 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10017550 74 / 8e-18 AT4G23750 172 / 2e-51 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2)
Lus10033938 37 / 0.0003 AT4G23750 201 / 6e-62 TARGET OF MONOPTEROS 3, cytokinin response factor 2 (.1.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10000543 pacid=23160072 polypeptide=Lus10000543 locus=Lus10000543.g ID=Lus10000543.BGIv1.0 annot-version=v1.0
ATGAGGGAGATTTTCGAGGAGACGACTGACATGGCCGTGGATGGGTTCCTGAACGACGACGTGTTTTCGAGCTCCGTCGATTTGGGGTTAGGGTTGTCCA
GCTGGAGCCGTGAAGATTGTTTTAAGGACATCGGCGGGTTGTTTGACTCGGATTCTCTGCTCGCCGCTTGA
AA sequence
>Lus10000543 pacid=23160072 polypeptide=Lus10000543 locus=Lus10000543.g ID=Lus10000543.BGIv1.0 annot-version=v1.0
MREIFEETTDMAVDGFLNDDVFSSSVDLGLGLSSWSREDCFKDIGGLFDSDSLLAA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10000543 0 1
AT4G23750 AP2_ERF TMO3, CRF2 TARGET OF MONOPTEROS 3, cytoki... Lus10017550 1.0 0.8793
AT5G67420 AS2 ASL39, LBD37 ASYMMETRIC LEAVES2-LIKE 39, LO... Lus10018697 5.5 0.7171
AT5G06760 AtLEA4-5, LEA4-... Late Embryogenesis Abundant 4-... Lus10021044 11.0 0.7107
AT5G22350 ELM1 ELONGATED MITOCHONDRIA 1, Prot... Lus10021334 12.1 0.7396
AT5G60890 MYB AtMYB34, MYB34,... ALTERED TRYPTOPHAN REGULATION ... Lus10015713 12.4 0.7164
AT4G18593 dual specificity protein phosp... Lus10013914 13.3 0.7444
AT5G38195 Bifunctional inhibitor/lipid-t... Lus10033573 18.8 0.7109
AT2G02120 PDF2.1, LCR70 LOW-MOLECULAR-WEIGHT CYSTEINE-... Lus10019226 28.9 0.7017
AT5G14210 Leucine-rich repeat protein ki... Lus10035225 40.6 0.7037
AT5G13790 MADS AGL15 AGAMOUS-like 15 (.1) Lus10039580 42.0 0.6952

Lus10000543 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.