Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01680 89 / 1e-22 SEOR1, SEOb Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022306 [exp] 122 / 2e-34 AT3G01680 735 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10014580 [exp] 116 / 3e-32 AT3G01680 758 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10032103 [exp] 116 / 3e-32 AT3G01680 757 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10022305 [exp] 115 / 6e-32 AT3G01680 744 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10000548 [exp] 115 / 6e-32 AT3G01680 677 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10000551 [exp] 61 / 2e-12 AT3G01680 539 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10022304 [exp] 60 / 2e-12 AT3G01680 590 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10021828 [exp] 59 / 4e-12 AT3G01680 592 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Lus10034567 [exp] 59 / 4e-12 AT3G01680 590 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G071000 [exp] 108 / 1e-29 AT3G01680 693 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.001G340600 [exp] 105 / 1e-28 AT3G01680 746 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.001G340400 [exp] 104 / 3e-28 AT3G01680 724 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.001G340300 [exp] 103 / 5e-28 AT3G01680 718 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.001G340500 [exp] 103 / 1e-27 AT3G01680 730 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.001G340200 [exp] 102 / 2e-27 AT3G01680 724 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.008G183200 [exp] 64 / 5e-14 AT3G01680 576 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.012G090400 [exp] 59 / 5e-12 AT3G01680 348 / 3e-109 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.010G050300 [exp] 57 / 3e-11 AT3G01680 577 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein Potri.010G050501 [exp] 57 / 3e-11 AT3G01680 575 / 0.0 Sieve-Element-Occlusion-Related 1, sieve element occlusion b, unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000546 pacid=23161694 polypeptide=Lus10000546 locus=Lus10000546.g ID=Lus10000546.BGIv1.0 annot-version=v1.0 ATGATGTGGTTCTTCTGGACAAGGCTGGAGAGCATGCTGTTCTCCAAGATCCAGCTGGGGAAGAATGATGATCAGGACCCTATGATGCTGGAGATCAAGA AGCTGTTGAGCTATGACAAGGAAGGAGGATGGGCGGTCCTCAGCAAAGGTTCAACCATAATCTCAAATGGACATGGAAACAGTGGTTGA
AA sequence Show only first row Show all	>Lus10000546 pacid=23161694 polypeptide=Lus10000546 locus=Lus10000546.g ID=Lus10000546.BGIv1.0 annot-version=v1.0 MMWFFWTRLESMLFSKIQLGKNDDQDPMMLEIKKLLSYDKEGGWAVLSKGSTIISNGHGNSG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G01680		SEOR1, SEOb	Sieve-Element-Occlusion-Relate...		Lus10000546 [exp]	0	1
AT1G65390		ATPP2-A5	phloem protein 2 A5 (.1.2)		Lus10018301 [exp]	2.4	0.8971
AT3G45070			P-loop containing nucleoside t...		Lus10003068 [exp]	2.6	0.8971
AT5G67360		ARA12	Subtilase family protein (.1)		Lus10002393 [exp]	3.2	0.9007
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039501 [exp]	3.9	0.9194
AT2G37890			Mitochondrial substrate carrie...		Lus10016522 [exp]	4.2	0.8733
AT5G19730			Pectin lyase-like superfamily ...		Lus10034981 [exp]	5.3	0.9027
AT1G71050		HIPP20	heavy metal associated isopren...		Lus10042946 [exp]	5.5	0.9150
AT3G06060		TSC10A	TSC10A, NAD(P)-binding Rossman...		Lus10039502 [exp]	6.7	0.9083
AT4G05120		FUR1, ENT3, FLU...	FUDR RESISTANT 1, EQUILIBRATIV...		Lus10018523 [exp]	7.1	0.8028
AT2G29640		JOSL	JOSEPHIN-like protein (.1)		Lus10040691 [exp]	8.0	0.8745

Compare expression of checked genes

Lus10000546 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.