Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G29035 55 / 1e-10 Plant self-incompatibility protein S1 family (.1) AT4G16295 55 / 1e-10 SPH1 S-protein homologue 1 (.1) AT1G04645 51 / 3e-09 Plant self-incompatibility protein S1 family (.1) AT2G06090 49 / 2e-08 Plant self-incompatibility protein S1 family (.1) AT5G04350 49 / 3e-08 Plant self-incompatibility protein S1 family (.1) AT1G28306 48 / 3e-08 Plant self-incompatibility protein S1 family (.1) AT5G27238 47 / 1e-07 Plant self-incompatibility protein S1 family (.1) AT5G06020 45 / 1e-06 Plant self-incompatibility protein S1 family (.1) AT1G28305 43 / 3e-06 Plant self-incompatibility protein S1 family (.1) AT3G26880 41 / 2e-05 Plant self-incompatibility protein S1 family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000682 [exp] 213 / 2e-72 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1) Lus10000683 [exp] 208 / 7e-71 AT4G16295 57 / 5e-11 S-protein homologue 1 (.1) Lus10021634 [exp] 184 / 3e-61 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10021633 [exp] 166 / 2e-54 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1) Lus10011897 [exp] 96 / 8e-27 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1) Lus10022830 [exp] 94 / 6e-26 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1) Lus10039546 [exp] 83 / 3e-21 AT4G16295 56 / 3e-10 S-protein homologue 1 (.1) Lus10011896 [exp] 81 / 1e-20 AT2G06090 62 / 5e-13 Plant self-incompatibility protein S1 family (.1) Lus10016350 [exp] 79 / 5e-20 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G066900 [exp] 69 / 7e-16 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1) Potri.002G252500 [exp] 68 / 1e-15 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1) Potri.003G201300 [exp] 53 / 5e-10 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1) Potri.018G148366 [exp] 51 / 3e-09 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1) Potri.018G148630 [exp] 48 / 4e-08 AT1G04645 106 / 3e-30 Plant self-incompatibility protein S1 family (.1) Potri.004G199700 [exp] 48 / 5e-08 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1) Potri.010G008300 [exp] 45 / 6e-07 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1) Potri.004G199801 [exp] 45 / 1e-06 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1) Potri.018G148700 [exp] 45 / 1e-06 AT1G04645 88 / 5e-23 Plant self-incompatibility protein S1 family (.1) Potri.002G263900 [exp] 44 / 1e-06 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05938 [flax] [poplar] Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence Show only first row Show all	>Lus10000558 pacid=23169567 polypeptide=Lus10000558 locus=Lus10000558.g ID=Lus10000558.BGIv1.0 annot-version=v1.0 ATGAACGAGCTTAAAAATGACAAGAAAGCCATGAGGGTTCACTGCAAGTCCAAAGACGAGGACTTGGGGATCCATGATGTTCCAGTCGGGTCAGAGTACC AATGGAAGGTCAAGAACACCGATGCCAAAGCCACTCCCTTTACTTGTGGTATTTCTGCAAATGATAAGGTAATCGTGTTCGATGCATATTTCGATGATGC CGAGCTCTTGCAAAGGGTCAATGAGAACAATTCTTATTGGGTGGTTAAGGATGATGGTATTTATCTTCGTCAAGTTTGGAAGAACACCGACGTTTTGTGG AAACCATGGCCTTGA
AA sequence Show only first row Show all	>Lus10000558 pacid=23169567 polypeptide=Lus10000558 locus=Lus10000558.g ID=Lus10000558.BGIv1.0 annot-version=v1.0 MNELKNDKKAMRVHCKSKDEDLGIHDVPVGSEYQWKVKNTDAKATPFTCGISANDKVIVFDAYFDDAELLQRVNENNSYWVVKDDGIYLRQVWKNTDVLW KPWP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10000558 [exp]	0	1
AT3G51590		LTP12	lipid transfer protein 12 (.1)		Lus10004067 [exp]	1.0	1.0000
AT1G17930			Aminotransferase-like, plant m...		Lus10005482 [exp]	1.4	1.0000
					Lus10011636 [exp]	1.7	1.0000
AT3G16970			Plant self-incompatibility pro...		Lus10011753 [exp]	2.0	1.0000
AT4G16295		SPH1	S-protein homologue 1 (.1)		Lus10011892 [exp]	2.2	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10022473 [exp]	2.4	1.0000
AT4G10950			SGNH hydrolase-type esterase s...		Lus10023070 [exp]	2.6	1.0000
AT1G34575			FAD-binding Berberine family p...		Lus10023373 [exp]	2.8	1.0000
AT2G02340		ATPP2-B8	phloem protein 2-B8 (.1)		Lus10025662 [exp]	3.0	1.0000
AT4G27570			UDP-Glycosyltransferase superf...		Lus10013368 [exp]	3.2	1.0000

Compare expression of checked genes

Lus10000558 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.