Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G25440 52 / 2e-09 C3HZnF ZFWD1 zinc finger WD40 repeat protein 1 (.1) AT5G49200 49 / 2e-08 C3HZnF WD-40 repeat family protein / zfwd4 protein (ZFWD4) (.1) AT5G51980 48 / 3e-08 C3HZnF Transducin/WD40 repeat-like superfamily protein (.1.2) AT5G40880 45 / 4e-07 WD-40 repeat family protein / zfwd3 protein (ZFWD3) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021640 [exp] 100 / 3e-28 AT4G25440 185 / 7e-57 zinc finger WD40 repeat protein 1 (.1) Lus10021655 [exp] 100 / 3e-27 AT4G25440 169 / 3e-48 zinc finger WD40 repeat protein 1 (.1) Lus10021648 [exp] 100 / 1e-26 AT4G25440 321 / 1e-105 zinc finger WD40 repeat protein 1 (.1) Lus10021656 [exp] 89 / 1e-22 AT4G25440 329 / 9e-109 zinc finger WD40 repeat protein 1 (.1) Lus10034704 [exp] 78 / 5e-21 AT4G25440 74 / 3e-17 zinc finger WD40 repeat protein 1 (.1) Lus10001652 [exp] 80 / 2e-20 AT5G51980 192 / 2e-59 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10004085 [exp] 77 / 1e-19 AT4G25440 145 / 1e-42 zinc finger WD40 repeat protein 1 (.1) Lus10034716 [exp] 79 / 2e-19 AT5G51980 217 / 5e-67 Transducin/WD40 repeat-like superfamily protein (.1.2) Lus10032066 [exp] 78 / 1e-18 AT4G25440 343 / 5e-115 zinc finger WD40 repeat protein 1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G077800 [exp] 55 / 2e-10 AT5G51980 391 / 5e-132 Transducin/WD40 repeat-like superfamily protein (.1.2) Potri.012G134800 [exp] 51 / 3e-09 AT4G25440 600 / 0.0 zinc finger WD40 repeat protein 1 (.1) Potri.015G137200 [exp] 49 / 1e-08 AT4G25440 587 / 0.0 zinc finger WD40 repeat protein 1 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000559 pacid=23169574 polypeptide=Lus10000559 locus=Lus10000559.g ID=Lus10000559.BGIv1.0 annot-version=v1.0 ATGTTGTTGTGCTCTTGGAACAATGAGTCAGTTGGAATGTATGAGCTTCCATCATTTCGTGAAAAGGGGAGATTGTACTCCAAATGTGAAGTAAGGAGCT TGGGAGGAGGTACTGGAGGGATGTTCTTCACTGGAGATGCTTCTGGTGTGGTGACTGTATGGAAACTGGCACTAGAAGCGAAAAATGGAGCAGTAGAGGT ATAG
AA sequence Show only first row Show all	>Lus10000559 pacid=23169574 polypeptide=Lus10000559 locus=Lus10000559.g ID=Lus10000559.BGIv1.0 annot-version=v1.0 MLLCSWNNESVGMYELPSFREKGRLYSKCEVRSLGGGTGGMFFTGDASGVVTVWKLALEAKNGAVEV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G25440	C3HZnF	ZFWD1	zinc finger WD40 repeat protei...		Lus10000559 [exp]	0	1
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028863 [exp]	1.4	0.9275
AT3G24530			AAA-type ATPase family protein...		Lus10005293 [exp]	3.0	0.9264
AT5G47090			unknown protein		Lus10021704 [exp]	3.7	0.9159
AT4G03230			S-locus lectin protein kinase ...		Lus10012956 [exp]	3.9	0.9181
					Lus10034352 [exp]	4.2	0.9426
AT5G65550			UDP-Glycosyltransferase superf...		Lus10028864 [exp]	6.5	0.8985
AT2G19130			S-locus lectin protein kinase ...		Lus10012955 [exp]	7.2	0.8988
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10029816 [exp]	9.2	0.9018
					Lus10018837 [exp]	10.6	0.9234
AT4G33030		SQD1	sulfoquinovosyldiacylglycerol ...		Lus10032973 [exp]	11.2	0.8940

Compare expression of checked genes

Lus10000559 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.