Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60480 94 / 3e-26 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034728 [exp] 121 / 8e-38 AT3G60480 66 / 4e-16 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G054300 [exp] 92 / 2e-25 AT3G60480 89 / 3e-24 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000560 pacid=23169572 polypeptide=Lus10000560 locus=Lus10000560.g ID=Lus10000560.BGIv1.0 annot-version=v1.0 ATGGAGGAGGAGGACGGCGAAAGAAGTGAAAACAACCGGTGGGTATGGTGGGGTGTTGGAAGCACCGTCCTGATGGGTTGGGGAGTGTTTTCGTGGCGGA GAGGCTACGCCGGAGACGGTAGGTTGATGCCGTTGAAAGCGTTCGCAGTTGCATCTCTGTTTGTGGGATCCGCTGCTTCGGCCTCCTTCTGCGCCCTTCG TGCTTCCGGCATCCACAAGGTTGAGGATCTGGTGCAGGTGGGTGCAGGTATAAGGACCCAGCTCGGGATCCCTTCAAGGCCACATCACAAGAGGAGAGAT TCTTGA
AA sequence Show only first row Show all	>Lus10000560 pacid=23169572 polypeptide=Lus10000560 locus=Lus10000560.g ID=Lus10000560.BGIv1.0 annot-version=v1.0 MEEEDGERSENNRWVWWGVGSTVLMGWGVFSWRRGYAGDGRLMPLKAFAVASLFVGSAASASFCALRASGIHKVEDLVQVGAGIRTQLGIPSRPHHKRRD S

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60480			unknown protein		Lus10000560 [exp]	0	1
AT1G08590			Leucine-rich receptor-like pro...		Lus10027951 [exp]	2.0	0.8636
AT4G11610		NTRB, ATNTRB	C2 calcium/lipid-binding plant...		Lus10000605 [exp]	3.7	0.8176
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10016179 [exp]	4.5	0.8062
AT2G20820			unknown protein		Lus10038583 [exp]	7.5	0.8143
AT5G20080			FAD/NAD(P)-binding oxidoreduct...		Lus10030059 [exp]	7.9	0.8774
AT1G20870			HSP20-like chaperones superfam...		Lus10013203 [exp]	8.7	0.8350
AT5G07960			unknown protein		Lus10034695 [exp]	13.3	0.7996
AT1G52340		SIS4, SDR1, ISI...	SHORT-CHAIN DEHYDROGENASE REDU...		Lus10016354 [exp]	18.3	0.7721
AT3G54320	AP2_ERF	ATWRI1, ASML1, ...	WRINKLED 1, WRINKLED, ACTIVATO...		Lus10028880 [exp]	21.2	0.8118
AT1G51160			SNARE-like superfamily protein...		Lus10039298 [exp]	21.6	0.8298

Compare expression of checked genes

Lus10000560 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.