Lus10000561 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G61470 143 / 1e-40 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27820 140 / 4e-39 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT3G44240 136 / 1e-38 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G80780 136 / 5e-38 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
AT5G10960 135 / 1e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G06450 136 / 3e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT2G32070 134 / 3e-37 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT5G22250 129 / 4e-35 AtCAF1b CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G27890 128 / 9e-35 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
AT1G15920 121 / 2e-32 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001651 558 / 0 AT1G61470 167 / 4e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017905 546 / 0 AT1G06450 162 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035077 505 / 0 AT1G61470 162 / 6e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10008043 448 / 1e-159 AT1G06450 165 / 5e-48 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10035078 395 / 7e-139 AT1G06450 168 / 2e-49 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10000327 383 / 4e-134 AT1G06450 174 / 1e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10038113 305 / 3e-104 AT3G44240 140 / 3e-41 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10017894 228 / 3e-75 AT1G06450 47 / 8e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10007771 207 / 3e-65 AT1G61470 170 / 5e-51 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.018G038700 192 / 3e-59 AT1G61470 182 / 8e-56 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.003G181100 142 / 2e-40 AT1G80780 468 / 1e-168 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1.2.3)
Potri.001G046700 140 / 2e-39 AT2G32070 472 / 2e-170 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.018G020900 134 / 3e-37 AT2G32070 441 / 2e-158 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G205600 132 / 2e-36 AT5G22250 302 / 4e-103 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G187200 131 / 5e-36 AT2G32070 403 / 2e-143 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.016G073000 130 / 2e-35 AT3G44260 322 / 5e-111 CCR4- associated factor 1a, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.006G262500 129 / 2e-35 AT2G32070 443 / 5e-159 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.009G161500 125 / 5e-34 AT5G22250 387 / 1e-136 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Potri.004G200400 124 / 1e-33 AT5G22250 419 / 3e-149 CCR4- associated factor 1b, Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0219 RNase_H PF04857 CAF1 CAF1 family ribonuclease
Representative CDS sequence
>Lus10000561 pacid=23169570 polypeptide=Lus10000561 locus=Lus10000561.g ID=Lus10000561.BGIv1.0 annot-version=v1.0
ATGATGGAAGCTCATACAATCCAACCGAATCATTGTTCGAAGAGCACAATAGTGTCGGTGGACACTGAATTCCCAGGTTGCCACCGTCCGATACCGAGGT
ACGCTTCCGAGGAACTCCAATTTCAGAACTTGAAGTACAACGTCGGCGCAACCTCTCTGATTCAATTAGGGCTCACTCTGTCCAACTCCGAGGGCACCGT
CGGCGGAATCTGGCAATTCAATTTCCAATTCGACCTAGACCACGACCTTCACTGCCCAAATTCAATGCAGTTCTTGATCCTCCACGGCATCGATTTCAAC
AAACTGAAAACCCACGGGATTGACCGGGTCAAATTCGGCACGGCGTTCGGGAGGCTGATTGCGACAAGGCGGAGTCCGATTACGTGGATCACTTTCCACG
GAGTTTACGATTACGCCTATCTCGTGAAGGCGGTGAGTTTCCGTCCAGTTGCGGAATCATCGGCGGAATTCGTTAATTTTTTGGGGATCGGGTTTGATTC
GGTGGTGGATTGCAAGTACATGGCTAAGTTCTATGAAGAGACCGGGAGTGAAATTGGGTTGCAGAAGTTAGCGGATGCTTTGGGGGTTAAGAGAAGAGGG
GAGGCTCATACTGCCGCCTCTGATAGTTTGCTGACGGCGTTGGTTTACTTTGAGTTGAAGAAGAAACTGATGCTGTTGGGTGTTGATGAAGAGTCTTACG
TTGATTACGTCTATGGAATCAACACCAAAATCTCCAGGAAGCAGAAAGAGCCCCTCTTTCTACCAACTGCTCGACCAGGTCCTGTGTATCATCATCATCA
TCATCCTTATCCTCCTCATCTTTATCCTCGTAAGGTGCTGTATCCCATTCCATATCAGCATGGAGTCTTGCCTCCGAATGTGATGATGGGTCGTCGTTGG
GTTGATTGCTCATTAGCTCCAGCAGTATTAGTTCCCTCTTTCATCTACCGATAA
AA sequence
>Lus10000561 pacid=23169570 polypeptide=Lus10000561 locus=Lus10000561.g ID=Lus10000561.BGIv1.0 annot-version=v1.0
MMEAHTIQPNHCSKSTIVSVDTEFPGCHRPIPRYASEELQFQNLKYNVGATSLIQLGLTLSNSEGTVGGIWQFNFQFDLDHDLHCPNSMQFLILHGIDFN
KLKTHGIDRVKFGTAFGRLIATRRSPITWITFHGVYDYAYLVKAVSFRPVAESSAEFVNFLGIGFDSVVDCKYMAKFYEETGSEIGLQKLADALGVKRRG
EAHTAASDSLLTALVYFELKKKLMLLGVDEESYVDYVYGINTKISRKQKEPLFLPTARPGPVYHHHHHPYPPHLYPRKVLYPIPYQHGVLPPNVMMGRRW
VDCSLAPAVLVPSFIYR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G61470 Polynucleotidyl transferase, r... Lus10000561 0 1
AT1G61470 Polynucleotidyl transferase, r... Lus10035077 6.4 0.6877
AT5G23050 AAE17 acyl-activating enzyme 17 (.1) Lus10027257 17.5 0.6584
AT5G51410 LUC7 N_terminus domain-contain... Lus10027212 18.5 0.6702
AT2G15560 Putative endonuclease or glyco... Lus10019845 29.0 0.6588
AT2G20495 unknown protein Lus10022916 31.0 0.6500
AT5G41620 unknown protein Lus10003027 34.6 0.6232
AT5G52980 unknown protein Lus10000151 52.4 0.6184
AT5G60610 F-box/RNI-like superfamily pro... Lus10004718 61.2 0.6156
AT5G51280 DEAD-box protein abstrakt, put... Lus10008856 66.4 0.5993
AT5G49060 Heat shock protein DnaJ, N-ter... Lus10037502 72.7 0.6058

Lus10000561 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.