Lus10000573 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G32870 144 / 2e-44 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT2G25770 112 / 7e-32 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006042 261 / 1e-90 AT4G32870 145 / 3e-45 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10005477 123 / 3e-36 AT2G25770 172 / 2e-55 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10026898 84 / 3e-21 AT2G25770 128 / 2e-38 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10028262 53 / 6e-09 AT2G25770 75 / 2e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Lus10040227 52 / 2e-08 AT2G25770 75 / 6e-17 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G236800 161 / 1e-50 AT4G32870 179 / 1e-57 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237000 147 / 2e-45 AT4G32870 180 / 9e-59 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.006G237100 143 / 4e-44 AT4G32870 178 / 8e-58 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.018G046100 114 / 2e-32 AT2G25770 188 / 1e-61 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.008G063900 55 / 6e-10 AT4G32870 80 / 2e-19 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.010G193200 48 / 8e-08 AT2G25770 59 / 4e-12 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1.2)
Potri.006G237050 0 / 1 AT4G32870 0 / 1 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF10604 Polyketide_cyc2 Polyketide cyclase / dehydrase and lipid transport
Representative CDS sequence
>Lus10000573 pacid=23161757 polypeptide=Lus10000573 locus=Lus10000573.g ID=Lus10000573.BGIv1.0 annot-version=v1.0
ATGGAGGAAGCACAACAAGTCCAAGAAATGCAGCAGCCAAAGAGATGGGAAGGCAAAGCGACCGCGACGGGGAAACTAAAATCATCAGCAAGGCAAGTGT
GGCTGTTTTTCGACCGCGACTTCTGCAGTCTCCACAAGTGGTCCCCAAATCTGGACACGTGTCACCAGCTGGAAGGTGTGGTCGGGCAGCCCGGATTGGT
CCGTTACTGCGCTTCCAAGTCCAGTTGGTGCAAGGAACGACTGCTCGCCATTGATCCATCCGACCGATGCTTGAGCTACGAGATTCTCGACAACAACATC
GGCTTCGGATCCTACGTTGCCACCATCAGGGTTGTCGATGATCAGCCGCCCGGAGGTTGCTGCAGGATTGAATGGTCGTTCGTTGCTGAGCCGGTCACCG
GTTGGACCTTAGAGGGTTTGCATTCCTACCTCACTTCCAGCTTGGATTACATGGCTTCCAAAATCCAGGAGAGCTTACTGTGTAATGGAATTTAA
AA sequence
>Lus10000573 pacid=23161757 polypeptide=Lus10000573 locus=Lus10000573.g ID=Lus10000573.BGIv1.0 annot-version=v1.0
MEEAQQVQEMQQPKRWEGKATATGKLKSSARQVWLFFDRDFCSLHKWSPNLDTCHQLEGVVGQPGLVRYCASKSSWCKERLLAIDPSDRCLSYEILDNNI
GFGSYVATIRVVDDQPPGGCCRIEWSFVAEPVTGWTLEGLHSYLTSSLDYMASKIQESLLCNGI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G32870 Polyketide cyclase/dehydrase a... Lus10000573 0 1
Lus10003556 1.0 0.9724
AT4G17720 RNA-binding (RRM/RBD/RNP motif... Lus10011063 2.4 0.9546
AT4G10790 UBX domain-containing protein ... Lus10027684 2.4 0.9637
AT2G17700 STY8 serine/threonine/tyrosine kina... Lus10004153 4.5 0.9433
AT3G17220 ATPMEI2 pectin methylesterase inhibito... Lus10017347 4.9 0.9258
AT1G23550 SRO2 similar to RCD one 2 (.1) Lus10013012 5.9 0.9278
Lus10033727 6.5 0.9003
Lus10025141 6.9 0.9316
AT5G64560 MRS2-2, ATMGT9 magnesium transporter 9 (.1.2) Lus10021887 7.2 0.8730
AT4G32870 Polyketide cyclase/dehydrase a... Lus10006042 8.4 0.9324

Lus10000573 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.