Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G63740 91 / 5e-22 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63730 91 / 9e-22 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G41550 87 / 2e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G44510 86 / 2e-20 TAO1 target of AVRB operation1 (.1) AT5G41750 86 / 4e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) AT5G41540 86 / 5e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G63880 85 / 6e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT5G40910 85 / 6e-20 Disease resistance protein (TIR-NBS-LRR class) family (.1) AT1G69550 85 / 7e-20 disease resistance protein (TIR-NBS-LRR class) (.1) AT2G16870 84 / 2e-19 Disease resistance protein (TIR-NBS-LRR class) family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018616 [exp] 218 / 1e-66 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10039850 [exp] 218 / 2e-66 AT5G36930 573 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Lus10042752 [exp] 87 / 1e-22 AT4G16990 145 / 5e-41 RESISTANCE TO LEPTOSPHAERIA MACULANS 3, disease resistance protein (TIR-NBS class), putative Lus10030839 [exp] 92 / 3e-22 AT4G12010 552 / 7e-176 Disease resistance protein (TIR-NBS-LRR class) family (.1) Lus10014582 [exp] 84 / 5e-20 AT1G27170 186 / 9e-56 transmembrane receptors;ATP binding (.1.2) Lus10041060 [exp] 85 / 1e-19 AT5G17680 641 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Lus10032101 [exp] 84 / 2e-19 AT1G27170 270 / 6e-80 transmembrane receptors;ATP binding (.1.2) Lus10015453 [exp] 82 / 9e-19 AT1G27170 282 / 5e-84 transmembrane receptors;ATP binding (.1.2) Lus10011104 [exp] 81 / 1e-18 AT5G17680 574 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G056100 [exp] 146 / 2e-41 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.005G206400 [exp] 143 / 2e-40 AT5G36930 587 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.017G105501 [exp] 97 / 3e-26 AT5G36930 158 / 4e-45 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.019G003942 [exp] 98 / 2e-24 AT5G36930 591 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.013G097300 [exp] 98 / 2e-24 AT5G17680 598 / 0.0 disease resistance protein (TIR-NBS-LRR class), putative (.1) Potri.003G200500 [exp] 98 / 2e-24 AT3G14470 594 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.T127106 [exp] 98 / 2e-24 AT3G14470 594 / 0.0 NB-ARC domain-containing disease resistance protein (.1) Potri.019G003285 [exp] 96 / 1e-23 AT5G36930 640 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.004G230000 [exp] 93 / 1e-23 AT5G36930 169 / 4e-47 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2) Potri.T126306 [exp] 95 / 2e-23 AT3G14470 585 / 0.0 NB-ARC domain-containing disease resistance protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0173 [flax] [poplar] STIR PF01582 [flax] [poplar] TIR TIR domain
Representative CDS sequence Show only first row Show all	>Lus10000574 pacid=23161756 polypeptide=Lus10000574 locus=Lus10000574.g ID=Lus10000574.BGIv1.0 annot-version=v1.0 ATGGAGACCGGCGGAGAGGTAGGCCCGGAGTGCCTGAGAGGGATCGAAGAGTCGAGGTTCTCCTTCGTGGTCCTGTCGAAACACTACGCTTCCTCGACCT GGTGTTTGGAAGAGCTTGTGTACATCCTCAAATGCAGGAGGGAGAGTGGTCACGGCGTCTGGCCGGTGTTCTACGGCGTGGATCCGTCGGACGTCGAGGA GTGCAAAGGGAGCTTCGCAGATGCGTTCGCCGAGCACGAGGCGGAATTCAAAACGGACATGGAAACAGGGAAGAGGAAGATCGACAAGTGGGAAGGGTTT GCTGCGCGGAATGAAGAGTGGAAATCTGCGCTCCGTGAAGTGTCTTATCTGAAAGGATTGGATGTACGGAACCACGCTGATGGGTACGTGAGTTTCGCCA TTTCTAATCGAATTCCAATGGATTCTGTTTCTTAG
AA sequence Show only first row Show all	>Lus10000574 pacid=23161756 polypeptide=Lus10000574 locus=Lus10000574.g ID=Lus10000574.BGIv1.0 annot-version=v1.0 METGGEVGPECLRGIEESRFSFVVLSKHYASSTWCLEELVYILKCRRESGHGVWPVFYGVDPSDVEECKGSFADAFAEHEAEFKTDMETGKRKIDKWEGF AARNEEWKSALREVSYLKGLDVRNHADGYVSFAISNRIPMDSVS

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16990		RLM3	RESISTANCE TO LEPTOSPHAERIA MA...		Lus10000574 [exp]	0	1
AT3G62710			Glycosyl hydrolase family prot...		Lus10034128 [exp]	1.0	0.8273
AT2G27520			F-box and associated interacti...		Lus10004586 [exp]	2.0	0.7545
AT2G34930			disease resistance family prot...		Lus10039514 [exp]	5.6	0.6522
					Lus10035698 [exp]	34.5	0.6363
AT3G29240			Protein of unknown function (D...		Lus10030696 [exp]	36.5	0.7058
AT1G30800			Fasciclin-like arabinogalactan...		Lus10038414 [exp]	41.1	0.7027
AT1G68390			Core-2/I-branching beta-1,6-N-...		Lus10036610 [exp]	45.6	0.6837
					Lus10022865 [exp]	64.3	0.6317
AT1G77700			Pathogenesis-related thaumatin...		Lus10028079 [exp]	72.2	0.6114
AT3G22142			Bifunctional inhibitor/lipid-t...		Lus10016490 [exp]	84.3	0.6433

Compare expression of checked genes

Lus10000574 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.