Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G35658 75 / 5e-19 unknown protein AT5G07490 58 / 6e-12 unknown protein AT5G61630 54 / 1e-10 unknown protein AT4G16840 38 / 9e-05 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011000 [exp] 96 / 4e-27 AT2G35658 74 / 5e-18 unknown protein Lus10032501 [exp] 56 / 2e-11 AT5G61630 129 / 2e-39 unknown protein Lus10042998 [exp] 56 / 5e-11 AT5G07490 117 / 2e-34 unknown protein Lus10019440 [exp] 38 / 8e-05 AT5G20045 63 / 9e-15 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G081900 [exp] 71 / 5e-18 AT2G35658 84 / 3e-23 unknown protein Potri.001G152700 [exp] 67 / 3e-16 AT2G35658 81 / 1e-21 unknown protein Potri.001G080500 [exp] 58 / 4e-12 AT5G61630 155 / 2e-49 unknown protein Potri.008G015800 [exp] 45 / 7e-08 AT5G20045 57 / 3e-12 unknown protein Potri.008G015100 [exp] 43 / 6e-07 AT5G20045 52 / 3e-10 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000594 pacid=23143622 polypeptide=Lus10000594 locus=Lus10000594.g ID=Lus10000594.BGIv1.0 annot-version=v1.0 ATGCAGAGATCGGCGAGCACCTCACGGATCTCCTCCTCCTCCGCCGCCGCGGCCGCCGAAGCCGAGTCGGCGATCTATTCCGCCTCGTCGGCGTTCGGAC TCCTTCCGACGTACGATCCGACCTCCCACGCTGCGAGGAAGGAAATGTCAAGAGTCAGAGCTGCGGAGAACGCCGTCCACTTCATCCCGCTCCTCCTCTT GGCCTCCGCCGTCATCCTCTGGTTCTTCTCCGGCCCTGGTAATCGACTAATCGTTGATCTGTAG
AA sequence Show only first row Show all	>Lus10000594 pacid=23143622 polypeptide=Lus10000594 locus=Lus10000594.g ID=Lus10000594.BGIv1.0 annot-version=v1.0 MQRSASTSRISSSSAAAAAEAESAIYSASSAFGLLPTYDPTSHAARKEMSRVRAAENAVHFIPLLLLASAVILWFFSGPGNRLIVDL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G35658			unknown protein		Lus10000594 [exp]	0	1
AT2G42940	AT-hook		Predicted AT-hook DNA-binding ...		Lus10020763 [exp]	5.3	0.6889
AT1G31040			PLATZ transcription factor fam...		Lus10038365 [exp]	7.1	0.7079
AT2G27410	B3		Domain of unknown function (DU...		Lus10000815 [exp]	7.5	0.6294
AT1G18210			Calcium-binding EF-hand family...		Lus10009059 [exp]	28.4	0.6816
AT3G11820		PEN1, AT-SYR1, ...	PENETRATION1, SYNTAXIN RELATED...		Lus10021263 [exp]	28.9	0.6832
AT4G00330		CRCK2	calmodulin-binding receptor-li...		Lus10018828 [exp]	31.5	0.6607
					Lus10007510 [exp]	32.6	0.6470
AT5G55390		EDM2	ENHANCED DOWNY MILDEW 2 (.1.2)		Lus10038454 [exp]	34.5	0.6062
					Lus10026821 [exp]	34.9	0.5960
AT5G58600		TBL44, PMR5	TRICHOME BIREFRINGENCE-LIKE 44...		Lus10031871 [exp]	35.7	0.6586

Compare expression of checked genes

Lus10000594 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.