Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16835 117 / 1e-32 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G33170 113 / 4e-31 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G56690 111 / 2e-30 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G68930 110 / 5e-30 pentatricopeptide (PPR) repeat-containing protein (.1) AT4G02750 108 / 2e-29 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G59720 108 / 2e-29 CRR28 CHLORORESPIRATORY REDUCTION28, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G49170 108 / 3e-29 EMB2261 embryo defective 2261, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G22070 107 / 5e-29 pentatricopeptide (PPR) repeat-containing protein (.1) AT1G47580 102 / 8e-29 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT2G41080 105 / 2e-28 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010998 [exp] 145 / 2e-42 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10040577 [exp] 115 / 2e-32 AT1G25360 577 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10022629 [exp] 114 / 3e-31 AT2G41080 723 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10020588 [exp] 107 / 3e-30 AT2G27610 422 / 2e-142 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10004892 [exp] 110 / 6e-30 AT2G27610 998 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10030908 [exp] 109 / 1e-29 AT1G68930 928 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10030581 [exp] 108 / 2e-29 AT1G68930 910 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10019689 [exp] 102 / 2e-29 AT2G22070 246 / 4e-78 pentatricopeptide (PPR) repeat-containing protein (.1) Lus10013540 [exp] 108 / 3e-29 AT4G02750 1075 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G081700 [exp] 124 / 8e-35 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.002G027800 [exp] 113 / 6e-31 AT1G25360 1047 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.010G136200 [exp] 112 / 9e-31 AT1G68930 997 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.016G075000 [exp] 111 / 2e-30 AT2G41080 755 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G058300 [exp] 109 / 8e-30 AT2G15690 499 / 2e-170 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.001G075800 [exp] 109 / 1e-29 AT3G57430 1189 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 84, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.004G047800 [exp] 108 / 2e-29 AT4G13650 654 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.007G085500 [exp] 107 / 9e-29 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.016G053500 [exp] 105 / 2e-28 AT5G52630 785 / 0.0 mitochondrial RNAediting factor 1 (.1) Potri.003G191000 [exp] 105 / 3e-28 AT1G11290 1178 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000596 pacid=23143625 polypeptide=Lus10000596 locus=Lus10000596.g ID=Lus10000596.BGIv1.0 annot-version=v1.0 ATGCTGCTGAGACACAGCGAGAAGCTGGCGATTGCGTACGGGCTGATGAAGCTGCCGGAAAGTGTTCCGATTCGAGTGTTTAAGAACTTGAGGATATGCG AGGACTGCCACCGTGCATCCAAGTGGATCTCAAAAGTCGAAGGGAAGGAGATTGTCGTGAGGGATACTACGAGGTTTCATCGCTTTAAAGATGGGTCTTG CTCTTGTGGAGATTACTGGTAG
AA sequence Show only first row Show all	>Lus10000596 pacid=23143625 polypeptide=Lus10000596 locus=Lus10000596.g ID=Lus10000596.BGIv1.0 annot-version=v1.0 MLLRHSEKLAIAYGLMKLPESVPIRVFKNLRICEDCHRASKWISKVEGKEIVVRDTTRFHRFKDGSCSCGDYW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16835			Tetratricopeptide repeat (TPR)...		Lus10000596 [exp]	0	1
					Lus10032721 [exp]	5.3	0.6871
AT1G16760			Protein kinase protein with ad...		Lus10033340 [exp]	18.9	0.6269
AT5G20990		B73, CNX1, SIR4...	SIRTINOL 4, CO-FACTOR FOR NITR...		Lus10000717 [exp]	19.3	0.6475
AT1G07360	C3HZnF	MAC5A	MOS4-associated complex subuni...		Lus10012448 [exp]	24.0	0.6170
					Lus10008005 [exp]	32.8	0.6154
AT2G27550		ATC	centroradialis (.1)		Lus10020600 [exp]	35.4	0.6215
					Lus10031183 [exp]	37.0	0.6127
AT4G19770			Glycosyl hydrolase family prot...		Lus10003408 [exp]	38.5	0.6078
AT5G02920			F-box/RNI-like superfamily pro...		Lus10035325 [exp]	40.4	0.6111
AT1G02520		MDR8, ABCB11, P...	multi-drug resistance 8, ATP-b...		Lus10004530 [exp]	41.8	0.6102

Compare expression of checked genes

Lus10000596 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.