Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G16835 72 / 1e-15 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT3G03580 52 / 1e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G37310 51 / 2e-08 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G03800 51 / 3e-08 EMB166, EMB175, EMB1899 embryo defective 1899, EMBRYO DEFECTIVE 175, EMBRYO DEFECTIVE 166, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT5G48910 51 / 3e-08 LPA66 LOW PSII ACCUMULATION 66, Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G74630 50 / 6e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G16860 50 / 8e-08 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G56690 49 / 1e-07 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G18840 49 / 1e-07 Tetratricopeptide repeat (TPR)-like superfamily protein (.2) AT2G21090 49 / 1e-07 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010998 [exp] 185 / 4e-56 AT4G16835 778 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10027455 [exp] 54 / 2e-09 AT3G29230 324 / 4e-102 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015256 [exp] 53 / 8e-09 AT5G46460 840 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017243 [exp] 52 / 9e-09 AT1G13410 539 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021068 [exp] 52 / 1e-08 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021069 [exp] 52 / 1e-08 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10042207 [exp] 51 / 3e-08 AT1G53600 406 / 6e-137 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10028907 [exp] 51 / 3e-08 AT4G22760 632 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10015874 [exp] 51 / 4e-08 AT2G45350 687 / 0.0 CHLORORESPIRATORY REDUCTION 4, Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G081700 [exp] 107 / 6e-28 AT4G16835 852 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.003G116100 [exp] 52 / 1e-08 AT4G22760 669 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G035900 [exp] 51 / 2e-08 AT1G74630 884 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.007G085500 [exp] 51 / 3e-08 AT2G22070 1088 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1) Potri.004G111300 [exp] 50 / 7e-08 AT3G02330 1077 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.016G051300 [exp] 50 / 7e-08 AT3G13770 908 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.012G048800 [exp] 49 / 1e-07 AT4G02750 1099 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G121400 [exp] 49 / 1e-07 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G140400 [exp] 49 / 1e-07 AT3G29230 398 / 2e-132 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G106500 [exp] 49 / 2e-07 AT2G29760 422 / 4e-139 ORGANELLE TRANSCRIPT PROCESSING 81, Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [flax] [poplar] TPR PF01535 [flax] [poplar] PPR PPR repeat
Representative CDS sequence Show only first row Show all	>Lus10000598 pacid=23143628 polypeptide=Lus10000598 locus=Lus10000598.g ID=Lus10000598.BGIv1.0 annot-version=v1.0 ATGAACTTCTTTCGACGGAAGCTGAACACTCCTCCGGCGATCAATCTCCTCCGCCGTTCTCCTTCAACAATATATCCATGGCATCCTTTCTCCACCTCCA CCAAAGCCACCGCCGATTCTACTCCAATCAAGCAGCCACCGCCACCGCGATCGCCATCGACATACCATCACGGAGCAAACGACGTGATCCTCTCCAACAT GATGATCACCAGCTACATCCGCTCCGGCGATCTCGATTCGGCTCTCGACGTCTTCCTTAACATGACGATCAAAACTACAGTCACGTGGAACTCCATCTTG GCCGGATACTCGAAATCGCCGGGGAAATTGAGGGATGCACAGAAGGTGTTTGTGGAAATTCCTCAACCAGATACTCTCTTATAA
AA sequence Show only first row Show all	>Lus10000598 pacid=23143628 polypeptide=Lus10000598 locus=Lus10000598.g ID=Lus10000598.BGIv1.0 annot-version=v1.0 MNFFRRKLNTPPAINLLRRSPSTIYPWHPFSTSTKATADSTPIKQPPPPRSPSTYHHGANDVILSNMMITSYIRSGDLDSALDVFLNMTIKTTVTWNSIL AGYSKSPGKLRDAQKVFVEIPQPDTLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G16835			Tetratricopeptide repeat (TPR)...		Lus10000598 [exp]	0	1
AT5G52290		SHOC1	shortage in chiasmata 1 (.1)		Lus10014981 [exp]	100.1	0.5047
AT3G07450			Bifunctional inhibitor/lipid-t...		Lus10030541 [exp]	117.9	0.4802

Compare expression of checked genes

Lus10000598 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.