Lus10000601 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G63460 256 / 8e-89 ATGPX8 glutathione peroxidase 8 (.1)
AT4G11600 236 / 5e-80 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT2G31570 218 / 9e-74 ATGPX2 glutathione peroxidase 2 (.1)
AT2G43350 219 / 2e-73 ATGPX3 glutathione peroxidase 3 (.1.2)
AT4G31870 214 / 4e-71 ATGPX7 glutathione peroxidase 7 (.1)
AT2G25080 206 / 6e-68 ATGPX1 glutathione peroxidase 1 (.1)
AT3G63080 202 / 3e-67 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT2G48150 196 / 9e-65 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008023 313 / 8e-110 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10008022 255 / 4e-88 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10008499 252 / 5e-86 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008537 249 / 8e-86 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10000603 232 / 5e-79 AT4G11600 256 / 9e-88 glutathione peroxidase 6 (.1)
Lus10027021 226 / 7e-77 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10042418 217 / 4e-72 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10029651 210 / 3e-70 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
Lus10026887 211 / 7e-70 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G105100 273 / 3e-95 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.003G126100 251 / 1e-85 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105200 244 / 8e-84 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.007G126600 228 / 3e-77 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.006G265400 209 / 3e-69 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.014G138800 200 / 2e-66 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 146 / 4e-45 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10000601 pacid=23144305 polypeptide=Lus10000601 locus=Lus10000601.g ID=Lus10000601.BGIv1.0 annot-version=v1.0
ATGTCGAGCGAAGAACAACAGAGCCCGCATTCCATTTACGATTTCACTGTAAAGAATGCTAAGGGACATGCTGTAAGTCTCGGTATCTACAAGGGGAAGG
TCCTGCTTATTATCAATGTTGCTTCCAAATGTGGCATGACCAACTCAAACCACACGGAGCTGAATGCTTTGTATCACAAGTACAAAGATCAAGGGTTGGA
GATACTGGCATTCCCTTGCAACCAGTTTGGAGCAGAAGAACCAGGAAACAATGACGAGATTGAAGAATTCGTTTGCAGTAGATTCAAGTCCGAGTTCCCC
ATATTCGACAAGATTGAGGTGAATGGAGAGAATGCATCCCCACTGTACAAGTTGTTGAAGACAGGGAAATGGGGAATTTTCGGCGACGACATCCAATGGA
ACTTTGTCAAGTTCCTTGTCAACAAACAAGGCCAAGTTGTTGATCGTTACTACCCAACAACTTCTCCCCTAAGCATCGAGGTAAAGACATAA
AA sequence
>Lus10000601 pacid=23144305 polypeptide=Lus10000601 locus=Lus10000601.g ID=Lus10000601.BGIv1.0 annot-version=v1.0
MSSEEQQSPHSIYDFTVKNAKGHAVSLGIYKGKVLLIINVASKCGMTNSNHTELNALYHKYKDQGLEILAFPCNQFGAEEPGNNDEIEEFVCSRFKSEFP
IFDKIEVNGENASPLYKLLKTGKWGIFGDDIQWNFVKFLVNKQGQVVDRYYPTTSPLSIEVKT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G63460 ATGPX8 glutathione peroxidase 8 (.1) Lus10000601 0 1
AT5G19930 Protein of unknown function DU... Lus10017753 1.4 0.8778
AT4G27120 unknown protein Lus10043066 2.4 0.8587
AT1G76200 unknown protein Lus10012279 3.5 0.8753
AT2G36410 Family of unknown function (DU... Lus10023876 3.9 0.8617
AT1G64750 DSS1(I), ATDSS1... deletion of SUV3 suppressor 1(... Lus10030583 6.0 0.8671
AT5G60335 Thioesterase superfamily prote... Lus10009162 6.7 0.8371
AT3G52230 unknown protein Lus10038643 7.0 0.8579
AT5G09830 BolA-like family protein (.1) Lus10020861 7.1 0.8685
AT3G27100 unknown protein Lus10012534 7.2 0.8399
AT4G04780 MED21 mediator 21 (.1) Lus10024509 8.7 0.8259

Lus10000601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.