Lus10000603 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G11600 255 / 2e-87 LSC803, PHGPX, ATGPX6 glutathione peroxidase 6 (.1)
AT4G31870 217 / 2e-72 ATGPX7 glutathione peroxidase 7 (.1)
AT1G63460 212 / 2e-71 ATGPX8 glutathione peroxidase 8 (.1)
AT2G31570 211 / 1e-70 ATGPX2 glutathione peroxidase 2 (.1)
AT2G25080 207 / 2e-68 ATGPX1 glutathione peroxidase 1 (.1)
AT3G63080 201 / 1e-66 ATGPX5, MEE42 maternal effect embryo arrest 42, glutathione peroxidase 5 (.1)
AT2G43350 201 / 3e-66 ATGPX3 glutathione peroxidase 3 (.1.2)
AT2G48150 195 / 2e-64 ATGPX4 glutathione peroxidase 4 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008022 298 / 5e-105 AT4G11600 301 / 1e-105 glutathione peroxidase 6 (.1)
Lus10008499 274 / 9e-95 AT4G11600 307 / 2e-106 glutathione peroxidase 6 (.1)
Lus10008537 271 / 2e-94 AT4G11600 299 / 1e-104 glutathione peroxidase 6 (.1)
Lus10000601 231 / 9e-79 AT1G63460 256 / 2e-88 glutathione peroxidase 8 (.1)
Lus10008023 228 / 5e-76 AT1G63460 265 / 9e-91 glutathione peroxidase 8 (.1)
Lus10027021 219 / 4e-74 AT2G31570 266 / 2e-92 glutathione peroxidase 2 (.1)
Lus10042418 216 / 7e-72 AT4G31870 329 / 2e-115 glutathione peroxidase 7 (.1)
Lus10029651 214 / 7e-72 AT2G48150 274 / 2e-95 glutathione peroxidase 4 (.1)
Lus10026887 214 / 6e-71 AT4G31870 332 / 3e-116 glutathione peroxidase 7 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G105200 261 / 2e-90 AT4G11600 298 / 3e-104 glutathione peroxidase 6 (.1)
Potri.003G126100 258 / 1e-88 AT4G11600 307 / 9e-107 glutathione peroxidase 6 (.1)
Potri.001G105100 236 / 2e-80 AT1G63460 283 / 5e-99 glutathione peroxidase 8 (.1)
Potri.007G126600 225 / 5e-76 AT2G31570 281 / 1e-97 glutathione peroxidase 2 (.1)
Potri.006G265400 214 / 3e-71 AT2G25080 343 / 6e-121 glutathione peroxidase 1 (.1)
Potri.014G138800 199 / 4e-66 AT2G48150 271 / 1e-94 glutathione peroxidase 4 (.1)
Potri.018G017500 146 / 3e-45 AT2G25080 209 / 4e-69 glutathione peroxidase 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00255 GSHPx Glutathione peroxidase
Representative CDS sequence
>Lus10000603 pacid=23144300 polypeptide=Lus10000603 locus=Lus10000603.g ID=Lus10000603.BGIv1.0 annot-version=v1.0
ATGGCTACCAATTCCGAATCTCGTAAGTCCATCTACGACTTCACTGTTAAGGATGCTAGAGGGAATGATGTTGATCTCAGTATCTACAAGGAAAAAGTTC
TTTTGATCGTTAATGTTGCCTCCCAATGCAGATTGACCAATTCCAACTACACTGAGCTGACTCAGTTATGCCAGAAATACAAAGATCAAGGTATGGAGAT
CTTGGCATTTTCTTACAATCAGTTTGGGTCTCAGGAACTAGGCAACAATGATCAAATTGTGGAGTTTGCTTGTACTCGTTTCAAGGCCGAGTTCCCCATA
TTCGACAAGGTTGATGTGAATGGAAAAGAGGTTGCTCCAGTCTACAAGTACCTCAAGGCGAGCAAAAGTGGAATCTTTGGGGATGGTATCAAGTGGAACT
TCACCAAGTTCCTCGTCAACAAAGAGGGTCAGGTGGTTGATCGCTACGCTCCTACCACCTCCCCTCTCAGCATTAAGGTACCGGAAATCGCTTACTAG
AA sequence
>Lus10000603 pacid=23144300 polypeptide=Lus10000603 locus=Lus10000603.g ID=Lus10000603.BGIv1.0 annot-version=v1.0
MATNSESRKSIYDFTVKDARGNDVDLSIYKEKVLLIVNVASQCRLTNSNYTELTQLCQKYKDQGMEILAFSYNQFGSQELGNNDQIVEFACTRFKAEFPI
FDKVDVNGKEVAPVYKYLKASKSGIFGDGIKWNFTKFLVNKEGQVVDRYAPTTSPLSIKVPEIAY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G11600 LSC803, PHGPX, ... glutathione peroxidase 6 (.1) Lus10000603 0 1
AT1G76200 unknown protein Lus10012279 3.0 0.8598
AT5G63905 unknown protein Lus10007744 4.5 0.8026
AT1G27695 glycine-rich protein (.1.2) Lus10032855 6.5 0.8313
AT5G51880 2-oxoglutarate (2OG) and Fe(II... Lus10015014 6.7 0.7916
AT5G08290 YLS8 YELLOW-LEAF-SPECIFIC GENE 8, m... Lus10017390 7.1 0.8460
AT1G55310 ATSCL33, SR33, ... SC35-like splicing factor 33 (... Lus10013539 9.0 0.8027
AT4G29070 Phospholipase A2 family protei... Lus10035314 10.6 0.8073
AT2G27830 unknown protein Lus10020544 11.5 0.7785
AT2G30330 BLOS1 BLOC subunit 1, GCN5L1 family ... Lus10030147 12.8 0.8024
AT5G63905 unknown protein Lus10018677 13.6 0.7701

Lus10000603 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.