Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59530 170 / 1e-52 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G04380 165 / 7e-51 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G59540 165 / 2e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G43440 163 / 7e-50 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT1G04350 157 / 2e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06620 156 / 3e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G43450 155 / 9e-47 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30830 152 / 7e-46 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT1G06645 145 / 5e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G30840 145 / 5e-43 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033879 [exp] 256 / 3e-86 AT5G59540 312 / 8e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10000612 [exp] 240 / 7e-80 AT5G59540 337 / 2e-114 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10033878 [exp] 244 / 4e-79 AT5G59540 308 / 4e-100 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10041230 [exp] 171 / 2e-54 AT5G59530 270 / 1e-90 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10021943 [exp] 170 / 3e-52 AT1G06620 443 / 5e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10027585 [exp] 167 / 2e-51 AT1G06620 429 / 3e-150 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022195 [exp] 166 / 7e-51 AT1G06620 432 / 1e-151 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10034032 [exp] 162 / 2e-48 AT1G06620 374 / 1e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10022191 [exp] 159 / 3e-48 AT1G06620 456 / 3e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G222300 [exp] 187 / 6e-59 AT1G06620 340 / 3e-115 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073300 [exp] 176 / 1e-54 AT1G06620 455 / 7e-161 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073100 [exp] 165 / 1e-50 AT1G06650 414 / 2e-144 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.017G135800 [exp] 164 / 4e-50 AT1G06620 323 / 1e-108 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.017G136000 [exp] 162 / 1e-49 AT1G06620 314 / 2e-105 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.008G165400 [exp] 162 / 2e-49 AT1G06620 444 / 1e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073166 [exp] 161 / 6e-49 AT1G06620 470 / 7e-167 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.002G040700 [exp] 159 / 3e-48 AT1G06620 330 / 2e-111 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.013G045000 [exp] 156 / 4e-47 AT1G06620 369 / 6e-127 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.010G073232 [exp] 151 / 3e-45 AT1G06620 402 / 7e-140 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [flax] [poplar] Cupin PF03171 [flax] [poplar] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily
Representative CDS sequence Show only first row Show all	>Lus10000610 pacid=23144932 polypeptide=Lus10000610 locus=Lus10000610.g ID=Lus10000610.BGIv1.0 annot-version=v1.0 ATGGCGCTTGCGTGCCACTATTACCCGCGTTGTCCTGAACCGCACCGAACCCTGGGTGCCACAAACCATACAGACCGTTATTCCCTCACCATTGTGTTAC AGGACCATATAGGTGGCCTTCAAGTTTTGCATCAGGATCAATGGGTCAACGTGACCCCTCTGCCTGGAGCTCTTGTAATCAACATTGGAGAATTCATGCA GCTGATTACAAATGACAAATTCAAGAGTGCGGAGCATAGAGTTATTGTCAGGAATAACGATAGGGCATCTGTGGCAAGCTTTTTCTATCCAAACTCGTCC GATAAACTCAAAATCTACAGGCCTCCCAATGAGCTGCTTTCTGATGTAAGTCCACCAATCTACATGGATACTAGTTTTACTGAATTTATGGCAAATTTCA GGTCCAATGGATTGGATGGAAAGCCTACGCTCTCTCATTTCAGACGTCCCTGA
AA sequence Show only first row Show all	>Lus10000610 pacid=23144932 polypeptide=Lus10000610 locus=Lus10000610.g ID=Lus10000610.BGIv1.0 annot-version=v1.0 MALACHYYPRCPEPHRTLGATNHTDRYSLTIVLQDHIGGLQVLHQDQWVNVTPLPGALVINIGEFMQLITNDKFKSAEHRVIVRNNDRASVASFFYPNSS DKLKIYRPPNELLSDVSPPIYMDTSFTEFMANFRSNGLDGKPTLSHFRRP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Lus10000610 [exp]	0	1
					Lus10011769 [exp]	4.9	0.6590
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10031033 [exp]	6.2	0.7170
AT4G28850		ATXTH26, XTH26,...	xyloglucan endotransglucosylas...		Lus10034957 [exp]	8.8	0.7170
AT1G47980			unknown protein		Lus10017081 [exp]	9.2	0.5995
AT1G70780			unknown protein		Lus10039287 [exp]	10.8	0.7170
					Lus10027606 [exp]	12.8	0.7027
AT2G14440			Leucine-rich repeat protein ki...		Lus10005049 [exp]	14.5	0.6924
AT2G13570	CCAAT	NF-YB7	"nuclear factor Y, subunit B7"...		Lus10020899 [exp]	16.2	0.6500
AT4G37840		HKL3	hexokinase-like 3 (.1)		Lus10011584 [exp]	17.3	0.6590
AT3G08710		TRXH9, ATH9	THIOREDOXIN TYPE H 9, thioredo...		Lus10012859 [exp]	20.5	0.6430

Compare expression of checked genes

Lus10000610 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.