Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G33340 42 / 4e-06 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT2G28040 41 / 9e-06 Eukaryotic aspartyl protease family protein (.1) AT1G64830 39 / 5e-05 Eukaryotic aspartyl protease family protein (.1) AT2G35615 37 / 0.0002 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005118 [exp] 79 / 2e-20 AT5G33340 168 / 7e-51 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10018825 [exp] 73 / 4e-17 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002610 [exp] 61 / 8e-13 AT5G33340 392 / 2e-133 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10002612 [exp] 59 / 6e-12 AT5G33340 393 / 5e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10020279 [exp] 57 / 3e-11 AT5G33340 393 / 3e-134 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 55 / 1e-10 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024903 [exp] 55 / 1e-10 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041151 [exp] 53 / 5e-10 AT5G33340 445 / 1e-154 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041150 [exp] 53 / 6e-10 AT5G33340 399 / 2e-137 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G114400 [exp] 55 / 9e-11 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G087900 [exp] 53 / 4e-10 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000621 pacid=23147721 polypeptide=Lus10000621 locus=Lus10000621.g ID=Lus10000621.BGIv1.0 annot-version=v1.0 ATGGAGACTAACACGGACGGTGACTTGGCGCTTGAAACGTTGACTTTCCAGTCAATCGCGAGTCGTAGTGTCACATTTTCCAAGACTCTGATCGGATATG GCCACAATAATGCTGGAACGTTCAATGCTAATGGATTGGGGATTGTCCGATTAGGAGGTGGATCGGCTTCTCTCATTACCCAATGA
AA sequence Show only first row Show all	>Lus10000621 pacid=23147721 polypeptide=Lus10000621 locus=Lus10000621.g ID=Lus10000621.BGIv1.0 annot-version=v1.0 METNTDGDLALETLTFQSIASRSVTFSKTLIGYGHNNAGTFNANGLGIVRLGGGSASLITQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G64830			Eukaryotic aspartyl protease f...		Lus10000621 [exp]	0	1

Compare expression of checked genes

Lus10000621 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.