Lus10000625 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G58390 172 / 5e-54 Peroxidase superfamily protein (.1)
AT5G58400 172 / 7e-54 Peroxidase superfamily protein (.1)
AT5G05340 170 / 2e-53 Peroxidase superfamily protein (.1)
AT1G14550 146 / 4e-44 Peroxidase superfamily protein (.1)
AT1G14540 135 / 9e-40 Peroxidase superfamily protein (.1)
AT2G18150 131 / 5e-38 Peroxidase superfamily protein (.1)
AT4G36430 129 / 3e-37 Peroxidase superfamily protein (.1)
AT2G18140 126 / 4e-36 Peroxidase superfamily protein (.1)
AT5G66390 125 / 6e-36 Peroxidase superfamily protein (.1)
AT3G50990 121 / 4e-34 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006534 258 / 9e-88 AT5G05340 399 / 3e-140 Peroxidase superfamily protein (.1)
Lus10000346 253 / 8e-85 AT5G05340 394 / 8e-137 Peroxidase superfamily protein (.1)
Lus10034207 186 / 3e-59 AT5G05340 454 / 8e-162 Peroxidase superfamily protein (.1)
Lus10032786 181 / 2e-57 AT5G05340 403 / 1e-141 Peroxidase superfamily protein (.1)
Lus10009933 179 / 7e-57 AT5G05340 364 / 2e-126 Peroxidase superfamily protein (.1)
Lus10030148 177 / 2e-56 AT5G05340 410 / 3e-145 Peroxidase superfamily protein (.1)
Lus10003573 176 / 8e-56 AT5G05340 397 / 1e-139 Peroxidase superfamily protein (.1)
Lus10008581 170 / 2e-53 AT5G05340 367 / 6e-128 Peroxidase superfamily protein (.1)
Lus10024205 157 / 4e-50 AT1G14550 212 / 3e-69 Peroxidase superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G143200 202 / 5e-66 AT5G05340 404 / 5e-142 Peroxidase superfamily protein (.1)
Potri.013G083600 183 / 2e-58 AT5G05340 483 / 2e-173 Peroxidase superfamily protein (.1)
Potri.013G156500 180 / 5e-57 AT5G05340 441 / 1e-156 Peroxidase superfamily protein (.1)
Potri.013G156400 174 / 2e-54 AT5G05340 412 / 1e-144 Peroxidase superfamily protein (.1)
Potri.016G132700 173 / 2e-54 AT5G05340 367 / 2e-127 Peroxidase superfamily protein (.1)
Potri.001G458900 168 / 2e-52 AT1G14540 389 / 3e-136 Peroxidase superfamily protein (.1)
Potri.001G458700 166 / 2e-51 AT1G14540 394 / 4e-138 Peroxidase superfamily protein (.1)
Potri.006G107000 164 / 4e-51 AT5G05340 349 / 2e-120 Peroxidase superfamily protein (.1)
Potri.016G132800 162 / 4e-50 AT5G05340 336 / 3e-115 Peroxidase superfamily protein (.1)
Potri.013G154400 159 / 4e-49 AT5G05340 363 / 3e-126 Peroxidase superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Lus10000625 pacid=23147723 polypeptide=Lus10000625 locus=Lus10000625.g ID=Lus10000625.BGIv1.0 annot-version=v1.0
ATGACCGTCCTGTCCGGCGGCCACACCGTCGGCCAAGCCCGGTGCACCACTTTCCGCAACCGGATCTACAACGAGACCAACATCGGACAGAACTTTGCCA
CCAACAGGAGGGCGAACTGCCCTGCCACTGCTGGCACGGGAGACGGGAACTTGGCCCCACTCGACTTCTCTCCGAACAGATTCGACAATGCTTATTACAG
GGAGCTTGTGGGCCAGCGTGGGCTACTGCACTCCGACCAGCAGCTGTTCAGCGGTGGGTCCCAAGATGCTTTGGTCAGGACTTATAGTACCAATGTCAAT
GCATTTGCTAGGGATTTCGCAAATGCCATGATTAGGATGGGGAACCTTAGTCCTCTTACTGGGACTAATGGCGAGATTAGACGTAATTGCAGGCTTATTA
ACTAA
AA sequence
>Lus10000625 pacid=23147723 polypeptide=Lus10000625 locus=Lus10000625.g ID=Lus10000625.BGIv1.0 annot-version=v1.0
MTVLSGGHTVGQARCTTFRNRIYNETNIGQNFATNRRANCPATAGTGDGNLAPLDFSPNRFDNAYYRELVGQRGLLHSDQQLFSGGSQDALVRTYSTNVN
AFARDFANAMIRMGNLSPLTGTNGEIRRNCRLIN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G05340 Peroxidase superfamily protein... Lus10000625 0 1
Lus10000296 8.6 0.7842
AT2G39200 ATMLO12, MLO12 MILDEW RESISTANCE LOCUS O 12, ... Lus10040388 12.0 0.8377
Lus10032744 14.4 0.7932
AT1G01490 Heavy metal transport/detoxifi... Lus10014967 18.8 0.8321
AT5G05340 Peroxidase superfamily protein... Lus10006535 22.4 0.8216
AT5G54510 DFL1, GH3.6 DWARF IN LIGHT 1, Auxin-respon... Lus10018510 27.9 0.8302
AT1G79580 NAC ANAC033, SMB, N... NAC (No Apical Meristem) domai... Lus10009939 46.6 0.8217
AT5G46490 Disease resistance protein (TI... Lus10042465 47.2 0.7780
AT5G05340 Peroxidase superfamily protein... Lus10000626 48.6 0.7488
AT1G68460 ATIPT1 Arabidopsis thaliana isopenten... Lus10034332 55.3 0.7656

Lus10000625 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.