Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023144 [exp] 74 / 2e-17 AT4G39950 604 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10023142 [exp] 59 / 5e-12 AT4G39950 345 / 4e-116 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10023143 [exp] 55 / 8e-11 AT4G39950 605 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031726 [exp] 43 / 2e-06 AT4G39950 573 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031151 [exp] 42 / 4e-06 AT4G39950 603 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031145 [exp] 39 / 5e-05 AT4G39950 561 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10026341 [exp] 39 / 7e-05 AT4G39950 563 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Lus10031727 [exp] 38 / 9e-05 AT5G35917 216 / 2e-65 "cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene", cytochrome P450, family 79, subfamily A, polypeptide 3 pseudogene (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G157200 [exp] 36 / 0.0005 AT4G39950 580 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1) Potri.013G157400 [exp] 35 / 0.0007 AT4G39950 556 / 0.0 "cytochrome P450, family 79, subfamily B, polypeptide 2", cytochrome P450, family 79, subfamily B, polypeptide 2 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000627 pacid=23175099 polypeptide=Lus10000627 locus=Lus10000627.g ID=Lus10000627.BGIv1.0 annot-version=v1.0 ATGCTTCTGGCGAGGCTGCTCCAGTGCTTCTCATGGACCCCCCCGGGGAACGCCAAGTCCATCGATCTGACCGTGGATGATATGAGTGATGAGCTGATCA TGAAGCTGCCGCTCACGGCTACCGCTACGCCGCGTTTGGCTGCCCCCTTGTACCCCAAGATTACCAACTGA
AA sequence Show only first row Show all	>Lus10000627 pacid=23175099 polypeptide=Lus10000627 locus=Lus10000627.g ID=Lus10000627.BGIv1.0 annot-version=v1.0 MLLARLLQCFSWTPPGNAKSIDLTVDDMSDELIMKLPLTATATPRLAAPLYPKITN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G05260		CYP79A2	cytochrome p450 79a2 (.1)		Lus10000627 [exp]	0	1
AT4G39950		CYP79B2	"cytochrome P450, family 79, s...		Lus10023144 [exp]	1.0	0.9830
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10023140 [exp]	1.7	0.9160
AT1G06475			unknown protein		Lus10015269 [exp]	2.0	0.8958
AT3G26300		CYP71B34	"cytochrome P450, family 71, s...		Lus10011499 [exp]	2.0	0.9210
AT2G38860		YLS5	Class I glutamine amidotransfe...		Lus10014721 [exp]	4.2	0.8660
AT3G13130			unknown protein		Lus10039066 [exp]	8.4	0.8638
AT3G43660			Vacuolar iron transporter (VIT...		Lus10025685 [exp]	8.4	0.8883
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10000632 [exp]	8.5	0.8522
AT2G02240		MEE66	maternal effect embryo arrest ...		Lus10018171 [exp]	9.4	0.8550
AT2G26690			Major facilitator superfamily ...		Lus10018553 [exp]	11.7	0.8633

Compare expression of checked genes

Lus10000627 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.