Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G59960 113 / 9e-31 NAD(P)-linked oxidoreductase superfamily protein (.1) AT1G59950 107 / 1e-28 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G62420 81 / 1e-18 NAD(P)-linked oxidoreductase superfamily protein (.1) AT5G01670 80 / 4e-18 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37770 79 / 6e-18 ChlAKR, AKR4C9 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) AT2G37760 78 / 1e-17 AKR4C8 Aldo-keto reductase family 4 member C8, NAD(P)-linked oxidoreductase superfamily protein AT3G53880 74 / 6e-16 AKR4C11 Aldo-keto reductase family 4 member C11, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G37790 73 / 8e-16 AKR4C10 Aldo-keto reductase family 4 member C10, NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21260 59 / 1e-10 NAD(P)-linked oxidoreductase superfamily protein (.1) AT2G21250 57 / 4e-10 NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011056 [exp] 248 / 4e-83 AT1G59960 325 / 8e-111 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10030946 [exp] 165 / 1e-50 AT1G59960 317 / 1e-107 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10040101 [exp] 124 / 2e-37 AT1G59960 96 / 7e-25 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10029208 [exp] 114 / 3e-31 AT1G59960 406 / 7e-143 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010720 [exp] 114 / 5e-31 AT1G59960 410 / 2e-144 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10027216 [exp] 81 / 2e-18 AT5G62420 429 / 2e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031739 [exp] 79 / 8e-18 AT5G62420 425 / 2e-150 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10031162 [exp] 78 / 2e-17 AT5G62420 431 / 1e-152 NAD(P)-linked oxidoreductase superfamily protein (.1) Lus10010884 [exp] 75 / 2e-16 AT2G37770 484 / 5e-174 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G040050 [exp] 127 / 3e-38 AT1G59960 135 / 9e-40 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.008G193100 [exp] 122 / 3e-34 AT1G59960 420 / 3e-148 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.010G036801 [exp] 108 / 2e-30 AT1G59960 187 / 2e-59 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.005G097000 [exp] 107 / 1e-28 AT1G59960 405 / 2e-142 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102300 [exp] 81 / 2e-18 AT2G37770 398 / 5e-140 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.001G125400 [exp] 73 / 1e-15 AT5G62420 445 / 2e-158 NAD(P)-linked oxidoreductase superfamily protein (.1) Potri.016G102032 [exp] 69 / 3e-14 AT2G37770 424 / 2e-150 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.016G102100 [exp] 69 / 4e-14 AT2G37770 400 / 5e-141 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.008G144600 [exp] 68 / 7e-14 AT2G37770 251 / 1e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2) Potri.010G097800 [exp] 67 / 2e-13 AT2G37770 250 / 3e-81 Chloroplastic aldo-keto reductase, Aldo-keto reductase family 4 member C9, NAD(P)-linked oxidoreductase superfamily protein (.1), NAD(P)-linked oxidoreductase superfamily protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00248 [flax] [poplar] Aldo_ket_red Aldo/keto reductase family
Representative CDS sequence Show only first row Show all	>Lus10000671 pacid=23144030 polypeptide=Lus10000671 locus=Lus10000671.g ID=Lus10000671.BGIv1.0 annot-version=v1.0 ATGGACATCAAAGTTCCTGGCGGCGGTGTTCGGAAGATGCCGGCGGTGGGCATGGGAACCTCCACCCACCCTTTACCGACGGAAGAAGTCATGGTCGCCG CCTTCCTCGACGCCATCGAGGTTCGGTACTGCCATTTCGACACCGCGGCTCTCTTCGGCTCGGAGGAGAGCGTGGGGAAAGCGGTGGCGGAAGCTGTGGA TAAGGGACTCGTCGGGAGTCGTGACGAGTTCTTCATCACGTCCAAGGCTTGGTGTACTGATCTTTATCCGGAACTCGTCGTCCCGGCACTTAAAAACAGT TTTCGGGAGTATAGAATGCAATGGAAGAGTGTTACAAACAAGGCCTATGTAAAGCTATTGGTGTTAGCAAGCAATTTCGGTCCTCCAAAGCTTTGTCAGC TACTCGATTACGCAACCATTCCTCCTTCAGTTAACCAACAAAAAGAACTGGTGGAGTTGTGTAAACAAAAGGGTGTTCAAGTTTGTGCTTGA
AA sequence Show only first row Show all	>Lus10000671 pacid=23144030 polypeptide=Lus10000671 locus=Lus10000671.g ID=Lus10000671.BGIv1.0 annot-version=v1.0 MDIKVPGGGVRKMPAVGMGTSTHPLPTEEVMVAAFLDAIEVRYCHFDTAALFGSEESVGKAVAEAVDKGLVGSRDEFFITSKAWCTDLYPELVVPALKNS FREYRMQWKSVTNKAYVKLLVLASNFGPPKLCQLLDYATIPPSVNQQKELVELCKQKGVQVCA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G59960			NAD(P)-linked oxidoreductase s...		Lus10000671 [exp]	0	1
AT1G63450		RHS8	root hair specific 8 (.1)		Lus10000604 [exp]	8.2	0.6226
AT5G19120			Eukaryotic aspartyl protease f...		Lus10039217 [exp]	9.3	0.4780
AT4G02270		RHS13	root hair specific 13 (.1)		Lus10005539 [exp]	12.7	0.6130
AT5G05500		MOP10	Pollen Ole e 1 allergen and ex...		Lus10009837 [exp]	21.3	0.5900
AT1G12560		ATHEXPALPHA1.26...	expansin A7 (.1)		Lus10006711 [exp]	21.9	0.5881
AT1G48930		ATGH9C1	glycosyl hydrolase 9C1 (.1)		Lus10017402 [exp]	25.0	0.5878
AT5G22410		RHS18	root hair specific 18 (.1)		Lus10004859 [exp]	26.1	0.5812
AT3G10710		RHS12	root hair specific 12 (.1)		Lus10033399 [exp]	26.2	0.5804
AT5G59190			subtilase family protein (.1)		Lus10040251 [exp]	26.8	0.6066
AT1G04110		SDD1	STOMATAL DENSITY AND DISTRIBUT...		Lus10029577 [exp]	30.2	0.5497

Compare expression of checked genes

Lus10000671 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.