Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G21430 120 / 4e-34 YUC11 Flavin-binding monooxygenase family protein (.1) AT1G48910 109 / 7e-30 YUC10 YUCCA 10, Flavin-containing monooxygenase family protein (.1) AT5G11320 94 / 3e-24 YUC4 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) AT1G04610 92 / 2e-23 YUC3 YUCCA 3 (.1) AT4G28720 92 / 4e-23 YUC8 YUCCA 8, Flavin-binding monooxygenase family protein (.1) AT5G43890 89 / 3e-22 YUCCA5, SUPER1, YUC5 YUCCA5, SUPPRESSOR OF ER 1, Flavin-binding monooxygenase family protein (.1) AT5G25620 89 / 5e-22 YUC6 YUCCA6, Flavin-binding monooxygenase family protein (.1.2) AT1G04180 88 / 1e-21 YUC9 YUCCA 9 (.1) AT4G32540 86 / 3e-21 YUC1, YUC YUCCA 1, YUCCA, Flavin-binding monooxygenase family protein (.1) AT2G33230 84 / 2e-20 YUC7 YUCCA 7 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002402 [exp] 172 / 1e-53 AT1G21430 427 / 5e-149 Flavin-binding monooxygenase family protein (.1) Lus10022851 [exp] 95 / 3e-24 AT4G28720 666 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Lus10035244 [exp] 91 / 8e-23 AT1G04610 692 / 0.0 YUCCA 3 (.1) Lus10007671 [exp] 91 / 8e-23 AT4G13260 518 / 0.0 YUCCA2, Flavin-binding monooxygenase family protein (.1) Lus10023695 [exp] 89 / 6e-22 AT1G04610 692 / 0.0 YUCCA 3 (.1) Lus10013125 [exp] 86 / 8e-21 AT5G11320 579 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Lus10008092 [exp] 84 / 2e-20 AT5G11320 575 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Lus10011274 [exp] 82 / 9e-20 AT4G28720 643 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Lus10032609 [exp] 82 / 1e-19 AT1G04610 248 / 7e-75 YUCCA 3 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G186100 [exp] 125 / 4e-36 AT1G21430 448 / 2e-157 Flavin-binding monooxygenase family protein (.1) Potri.005G111800 [exp] 124 / 1e-35 AT1G21430 425 / 4e-148 Flavin-binding monooxygenase family protein (.1) Potri.016G003300 [exp] 115 / 5e-32 AT1G21430 436 / 7e-153 Flavin-binding monooxygenase family protein (.1) Potri.002G207400 [exp] 110 / 2e-30 AT1G48910 429 / 3e-150 YUCCA 10, Flavin-containing monooxygenase family protein (.1) Potri.018G033200 [exp] 97 / 6e-25 AT5G11320 546 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Potri.006G248200 [exp] 95 / 2e-24 AT5G11320 598 / 0.0 YUCCA4, Flavin-binding monooxygenase family protein (.1.2) Potri.002G254200 [exp] 93 / 2e-23 AT4G28720 694 / 0.0 YUCCA 8, Flavin-binding monooxygenase family protein (.1) Potri.018G036800 [exp] 90 / 2e-22 AT5G25620 576 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2) Potri.006G243400 [exp] 88 / 6e-22 AT5G25620 608 / 0.0 YUCCA6, Flavin-binding monooxygenase family protein (.1.2) Potri.007G028200 [exp] 87 / 2e-21 AT5G25620 495 / 5e-175 YUCCA6, Flavin-binding monooxygenase family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10000677 pacid=23144921 polypeptide=Lus10000677 locus=Lus10000677.g ID=Lus10000677.BGIv1.0 annot-version=v1.0 ATGTACTCCATTCCCAACATCCTCTTAGGAAATGAAGATTGTTGTGCATCTCTATGGAGGAAACGAGCTTACGACCGTTTGAAACTACACCTAGCAAAGG AGTTTTGCGAGCTTCCTCACATGTCTTTCCCACCCAAGACTCCAAGGTTTGTCCCTAGAGATGGGTTCCTCAACTATTTGGACAATTATGTGTCCAAACT TGAAATAATCCCAAGGTACATGGAGAATGTTGAAAGTGCTATTCATGATAGGAATAGATGGACGGTTAGAGTGAAGGATTTGCAGCAAAAAGGGCTGTGA
AA sequence Show only first row Show all	>Lus10000677 pacid=23144921 polypeptide=Lus10000677 locus=Lus10000677.g ID=Lus10000677.BGIv1.0 annot-version=v1.0 MYSIPNILLGNEDCCASLWRKRAYDRLKLHLAKEFCELPHMSFPPKTPRFVPRDGFLNYLDNYVSKLEIIPRYMENVESAIHDRNRWTVRVKDLQQKGL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G21430		YUC11	Flavin-binding monooxygenase f...		Lus10000677 [exp]	0	1
AT2G15220			Plant basic secretory protein ...		Lus10001608 [exp]	1.0	1.0000
AT4G35580	NAC	NTL9, CBNAC	NAC transcription factor-like ...		Lus10005144 [exp]	1.4	1.0000
					Lus10024141 [exp]	1.7	1.0000
AT5G06720		ATPA2	peroxidase 2 (.1)		Lus10027988 [exp]	2.0	1.0000
					Lus10013255 [exp]	2.2	1.0000
					Lus10013259 [exp]	2.4	1.0000
AT1G61110	NAC	ANAC025	NAC domain containing protein ...		Lus10013964 [exp]	2.6	1.0000
AT3G06240			F-box family protein (.1)		Lus10014136 [exp]	2.8	1.0000
					Lus10028570 [exp]	3.0	1.0000
AT2G47140		AtSDR5	short-chain dehydrogenase redu...		Lus10029435 [exp]	3.2	1.0000

Compare expression of checked genes

Lus10000677 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.