Lus10000678 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G14130 404 / 3e-143 XTR7, XTH15 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
AT3G23730 404 / 4e-143 XTH16 xyloglucan endotransglucosylase/hydrolase 16 (.1)
AT4G25810 370 / 6e-130 XTH23, XTR6 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
AT5G57550 370 / 6e-130 XTR3, XTH25, EXGT-A5 xyloglucan endotransglycosylase 3, xyloglucan endotransglucosylase/hydrolase 25 (.1)
AT5G57560 362 / 6e-127 XTH22, TCH4 xyloglucan endotransglucosylase/hydrolase 22, Touch 4, Xyloglucan endotransglucosylase/hydrolase family protein (.1)
AT4G30270 360 / 3e-126 XTH24, SEN4, BRU1, MERI-5, MERI5B SENESCENCE 4, meristem-5, MERISTEM 5, xyloglucan endotransglucosylase/hydrolase 24 (.1)
AT5G57530 348 / 3e-121 AtXTH12, XTH12 xyloglucan endotransglucosylase/hydrolase 12 (.1)
AT5G57540 347 / 8e-121 AtXTH13, XTH13 xyloglucan endotransglucosylase/hydrolase 13 (.1)
AT2G18800 335 / 7e-116 ATXTH21, XTH21, XTR17 xyloglucan endotransglucosylase/hydrolase 21 (.1)
AT4G25820 334 / 7e-116 ATXTH14, XTR9, XTH14 xyloglucan endotransglycosylase 9, xyloglucan endotransglucosylase/hydrolase 14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10021638 528 / 0 AT3G23730 413 / 7e-147 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10028947 412 / 2e-146 AT4G14130 437 / 2e-156 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10008522 406 / 4e-144 AT3G23730 430 / 2e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10004723 399 / 3e-141 AT3G23730 431 / 1e-153 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010938 375 / 4e-132 AT4G14130 386 / 3e-136 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Lus10031393 374 / 2e-131 AT3G23730 388 / 8e-137 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10020773 374 / 3e-131 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10010939 373 / 4e-131 AT3G23730 384 / 2e-135 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Lus10007349 372 / 1e-130 AT3G23730 394 / 4e-139 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G146100 423 / 7e-151 AT3G23730 451 / 1e-161 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.002G236200 411 / 5e-146 AT3G23730 436 / 1e-155 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.005G201200 399 / 2e-141 AT4G14130 405 / 2e-143 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060500 399 / 3e-141 AT4G14130 424 / 3e-151 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.005G201250 399 / 4e-141 AT4G14130 395 / 2e-139 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.002G060400 387 / 2e-136 AT4G14130 402 / 2e-142 xyloglucan endotransglycosylase 7, xyloglucan endotransglucosylase/hydrolase 15 (.1)
Potri.018G095100 385 / 9e-136 AT4G25810 420 / 1e-149 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.011G077320 383 / 5e-135 AT3G23730 386 / 7e-136 xyloglucan endotransglucosylase/hydrolase 16 (.1)
Potri.018G095200 382 / 2e-134 AT4G25810 414 / 3e-147 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
Potri.013G005700 381 / 1e-133 AT4G25810 431 / 5e-153 xyloglucan endotransglucosylase/hydrolase 23, xyloglucan endotransglycosylase 6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0004 Concanavalin PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16
CL0004 Concanavalin PF06955 XET_C Xyloglucan endo-transglycosylase (XET) C-terminus
Representative CDS sequence
>Lus10000678 pacid=23144918 polypeptide=Lus10000678 locus=Lus10000678.g ID=Lus10000678.BGIv1.0 annot-version=v1.0
ATGGGTTTGTTCTCTGGTCCATTTGGGTTGCTAGTAGTACTCGTGATTAGTTGTTGTTTGGTAGGAGTTGCACTTGCGGGCAATTTCAACAAGGACTTCG
ACTTAACATGGGGAGGGCCACGAGCTAAGATCTCAAATGGTGGTCGGGATTTGTCTCTGTCGCTAGACAATACCTCTGGCTCTGGATTTCAATCCAAGAA
GGAGTACCTCTTTGGCAAGATTGACATGCAGCTTAAGCTCATCGCTGGCAACTCTGCTGGCACTGTCACTACTTACTACTTGTCATCTGAAGGGACTACA
CACGACGAAATCGACTTCGAATTCCTGGGAAACCTGAGCGGAGACCCGTACATTATCCACACCAACGTATTTAGTCAAGGCAAAGGAAACAGAGAGCAAC
AATTCTACTTATGGTTCGACCCGACACAAGACTACCATACTTACTCAGTCATATGGCTCCCACACCACATCGTGTTCTTGGTCGACAACACTCCTATTCG
TGTTTTCAAAAACGCTGAGTCCATGGGCGTACCGTTCCCCAAAAGCCAGCCCATGAGGATCCACTCAAGCCTGTGGAATGCAGACGATTGGGCTACCCGT
GGAGGCCTGGTGAAGACCGATTGGTCAAAGGCTCCATTCACGGCCTACTATCGTAACTTCAATTCTTTCGAGGTTTCGAAAACGCTGTCACCAAAGTCAT
TTTCGGATGGGAATTGGGAGTCGAAGGAGTTGGACGGCAAAGCGAGGAGGAGAGTGAGGTGGGTTCAGAAGAACTACATGATTTACAACTATTGCACAGA
CCTTAAGCGCTTCCCCCAAGGTTTTCCTGTCGAGTGTCGATCATGA
AA sequence
>Lus10000678 pacid=23144918 polypeptide=Lus10000678 locus=Lus10000678.g ID=Lus10000678.BGIv1.0 annot-version=v1.0
MGLFSGPFGLLVVLVISCCLVGVALAGNFNKDFDLTWGGPRAKISNGGRDLSLSLDNTSGSGFQSKKEYLFGKIDMQLKLIAGNSAGTVTTYYLSSEGTT
HDEIDFEFLGNLSGDPYIIHTNVFSQGKGNREQQFYLWFDPTQDYHTYSVIWLPHHIVFLVDNTPIRVFKNAESMGVPFPKSQPMRIHSSLWNADDWATR
GGLVKTDWSKAPFTAYYRNFNSFEVSKTLSPKSFSDGNWESKELDGKARRRVRWVQKNYMIYNYCTDLKRFPQGFPVECRS

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G23730 XTH16 xyloglucan endotransglucosylas... Lus10000678 0 1
AT1G26930 Galactose oxidase/kelch repeat... Lus10023608 4.6 0.7593
Lus10040421 4.7 0.8287
AT4G39220 ATRER1A Rer1 family protein (.1) Lus10002890 6.9 0.7383
AT4G00120 bHLH IND1, GT140, bH... INDEHISCENT, EMBRYO SAC DEVELO... Lus10033488 8.8 0.6762
AT1G58060 RNA helicase family protein (.... Lus10012694 13.5 0.6509
Lus10008145 15.1 0.5328
AT4G05230 Ubiquitin-like superfamily pro... Lus10007641 16.6 0.7766
AT2G34930 disease resistance family prot... Lus10001034 21.5 0.6327
AT1G35467 RALFL5 RALF-like 5 (.1) Lus10006213 22.0 0.6294
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029316 24.0 0.7433

Lus10000678 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.