Lus10000683 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G16295 58 / 5e-11 SPH1 S-protein homologue 1 (.1)
AT4G29035 54 / 7e-10 Plant self-incompatibility protein S1 family (.1)
AT2G06090 54 / 1e-09 Plant self-incompatibility protein S1 family (.1)
AT5G27238 52 / 8e-09 Plant self-incompatibility protein S1 family (.1)
AT5G04350 51 / 1e-08 Plant self-incompatibility protein S1 family (.1)
AT1G28306 50 / 4e-08 Plant self-incompatibility protein S1 family (.1)
AT1G04645 47 / 4e-07 Plant self-incompatibility protein S1 family (.1)
AT5G06020 47 / 7e-07 Plant self-incompatibility protein S1 family (.1)
AT3G26870 45 / 2e-06 Plant self-incompatibility protein S1 family (.1)
AT3G26880 44 / 5e-06 Plant self-incompatibility protein S1 family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10000682 303 / 3e-107 AT4G16295 56 / 4e-10 S-protein homologue 1 (.1)
Lus10021634 276 / 5e-97 AT4G29035 58 / 4e-11 Plant self-incompatibility protein S1 family (.1)
Lus10021633 244 / 2e-84 AT4G29035 57 / 4e-11 Plant self-incompatibility protein S1 family (.1)
Lus10000558 208 / 1e-70 AT4G16295 55 / 1e-10 S-protein homologue 1 (.1)
Lus10011897 115 / 2e-33 AT2G06090 73 / 2e-17 Plant self-incompatibility protein S1 family (.1)
Lus10022830 108 / 9e-31 AT2G06090 67 / 6e-15 Plant self-incompatibility protein S1 family (.1)
Lus10039546 95 / 4e-25 AT4G16295 56 / 3e-10 S-protein homologue 1 (.1)
Lus10016350 91 / 5e-24 AT2G06090 59 / 1e-11 Plant self-incompatibility protein S1 family (.1)
Lus10019779 92 / 6e-24 AT4G16295 58 / 6e-11 S-protein homologue 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G252500 77 / 1e-18 AT4G16295 116 / 9e-34 S-protein homologue 1 (.1)
Potri.016G066900 77 / 3e-18 AT4G29035 85 / 1e-21 Plant self-incompatibility protein S1 family (.1)
Potri.003G201300 62 / 9e-13 AT2G06090 65 / 5e-14 Plant self-incompatibility protein S1 family (.1)
Potri.004G199801 51 / 2e-08 AT4G16295 67 / 2e-14 S-protein homologue 1 (.1)
Potri.004G199700 51 / 2e-08 AT4G16295 69 / 2e-15 S-protein homologue 1 (.1)
Potri.003G175100 50 / 2e-08 ND /
Potri.010G008300 50 / 2e-08 AT3G17080 74 / 8e-18 Plant self-incompatibility protein S1 family (.1)
Potri.002G263900 49 / 4e-08 AT3G24060 46 / 5e-07 Plant self-incompatibility protein S1 family (.1)
Potri.018G148366 47 / 2e-07 AT1G04645 103 / 1e-29 Plant self-incompatibility protein S1 family (.1)
Potri.006G170200 48 / 3e-07 AT5G12060 48 / 1e-07 Plant self-incompatibility protein S1 family (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF05938 Self-incomp_S1 Plant self-incompatibility protein S1
Representative CDS sequence
>Lus10000683 pacid=23144914 polypeptide=Lus10000683 locus=Lus10000683.g ID=Lus10000683.BGIv1.0 annot-version=v1.0
ATGAAACTAGTAGCATTTTCGGTTGTCCTAACATTGGTTATCACCGTCGGTGTGGCTCTAGCCTCCGGTGCTCCGGCCGATGCTGATAAAGGAAGTGTGG
TCCCATCAACTTCAAAACCTGTACAGTCGGCAGATTTTACAGAGGTTCACGTGATGAACGAACTCAAGAATGACAAGAAAGCCATGAGGGTTCACTGCAA
GTCCAAAGACGAGGACTTGGGGATCCATGATGTTCCAGTCGGGTCAGAGTACCAATGGAAGGTCAAAAACACTGATGCCACAGCCACTCCCTTTACTTGT
GGTATTTCAGCAAACGATAAAGAAATCATATTCAACGCATATTTCGAAGATGCCGAGCTCTTGCGAAGAGTCAACGAGAACAACTCTTATTGGGTGGTTA
AGGATGATGGCATTTATCTTCGTCAAGTTTGGAAGAACACCGACATTTTTTGGCAACCATGGCCTTGA
AA sequence
>Lus10000683 pacid=23144914 polypeptide=Lus10000683 locus=Lus10000683.g ID=Lus10000683.BGIv1.0 annot-version=v1.0
MKLVAFSVVLTLVITVGVALASGAPADADKGSVVPSTSKPVQSADFTEVHVMNELKNDKKAMRVHCKSKDEDLGIHDVPVGSEYQWKVKNTDATATPFTC
GISANDKEIIFNAYFEDAELLRRVNENNSYWVVKDDGIYLRQVWKNTDIFWQPWP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G16295 SPH1 S-protein homologue 1 (.1) Lus10000683 0 1
Lus10001790 2.0 1.0000
AT4G17810 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers sup... Lus10000481 2.2 1.0000
Lus10006164 2.8 1.0000
AT5G13660 unknown protein Lus10005963 3.9 1.0000
AT5G55050 GDSL-like Lipase/Acylhydrolase... Lus10030409 5.0 1.0000
AT2G01690 ARM repeat superfamily protein... Lus10003679 5.2 0.9937
AT5G20260 Exostosin family protein (.1) Lus10039981 5.5 1.0000
AT1G73700 MATE efflux family protein (.1... Lus10042705 5.9 1.0000
AT4G38260 Protein of unknown function (D... Lus10016023 6.3 0.9994
AT4G02320 Plant invertase/pectin methyle... Lus10001467 7.1 0.9887

Lus10000683 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.