Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G55125 102 / 1e-30 Ribosomal protein L31 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023572 [exp] 127 / 2e-36 AT5G42250 439 / 1e-152 Zinc-binding alcohol dehydrogenase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G314100 [exp] 113 / 4e-35 AT5G55125 108 / 5e-33 Ribosomal protein L31 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF01197 [flax] [poplar] Ribosomal_L31 Ribosomal protein L31
Representative CDS sequence Show only first row Show all	>Lus10000695 pacid=23173741 polypeptide=Lus10000695 locus=Lus10000695.g ID=Lus10000695.BGIv1.0 annot-version=v1.0 ATGAAGAAAGGAGCTCACCCACGAATACAATGGATATCCTATGTCACCCAGAGCGGCAGACTGATGAATGTTATGATGACAAAAATACACGACCCTGGTA AAGTCTACCACTTCAGAGCAAAGAGGCAAATGGCTGAAAGTCTGGGGCAAATTGCAAAGTTCAAGCGTCGCTACGGTCAGGTGAAGAACGAGGAAGAAAC TGAGAAAAAGTAA
AA sequence Show only first row Show all	>Lus10000695 pacid=23173741 polypeptide=Lus10000695 locus=Lus10000695.g ID=Lus10000695.BGIv1.0 annot-version=v1.0 MKKGAHPRIQWISYVTQSGRLMNVMMTKIHDPGKVYHFRAKRQMAESLGQIAKFKRRYGQVKNEEETEKK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G55125			Ribosomal protein L31 (.1.2)		Lus10000695 [exp]	0	1
					Lus10008602 [exp]	9.5	0.5793
AT5G20690			Leucine-rich repeat protein ki...		Lus10005175 [exp]	33.9	0.5345
AT1G01970			Tetratricopeptide repeat (TPR)...		Lus10015865 [exp]	39.5	0.5082
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10011999 [exp]	55.0	0.5232
AT2G29060	GRAS		GRAS family transcription fact...		Lus10037752 [exp]	60.2	0.5075
AT1G65450			HXXXD-type acyl-transferase fa...		Lus10029920 [exp]	61.3	0.5193
AT5G11730			Core-2/I-branching beta-1,6-N-...		Lus10034348 [exp]	63.4	0.5193
AT2G40190		LEW3	LEAF WILTING 3, UDP-Glycosyltr...		Lus10007909 [exp]	67.1	0.5148
AT4G02340			alpha/beta-Hydrolases superfam...		Lus10008682 [exp]	70.3	0.5138
AT1G60630			Leucine-rich repeat protein ki...		Lus10019429 [exp]	70.5	0.5123

Compare expression of checked genes

Lus10000695 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.