Lus10000700 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33920 94 / 2e-24 Protein phosphatase 2C family protein (.1)
AT3G51370 87 / 4e-22 Protein phosphatase 2C family protein (.1.2)
AT3G55050 86 / 3e-21 Protein phosphatase 2C family protein (.1.2)
AT3G12620 82 / 5e-20 Protein phosphatase 2C family protein (.1.2)
AT5G66080 79 / 6e-19 Protein phosphatase 2C family protein (.1)
AT5G06750 79 / 6e-19 Protein phosphatase 2C family protein (.1.2.3)
AT3G17090 77 / 2e-18 Protein phosphatase 2C family protein (.1.2)
AT5G02760 77 / 5e-18 Protein phosphatase 2C family protein (.1)
AT4G38520 69 / 2e-15 Protein phosphatase 2C family protein (.1.2)
AT3G16560 53 / 1e-09 Protein phosphatase 2C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011521 146 / 3e-44 AT4G33920 483 / 2e-171 Protein phosphatase 2C family protein (.1)
Lus10019302 145 / 6e-44 AT4G33920 472 / 4e-167 Protein phosphatase 2C family protein (.1)
Lus10013896 93 / 8e-24 AT4G33920 554 / 0.0 Protein phosphatase 2C family protein (.1)
Lus10002110 93 / 8e-24 AT4G33920 533 / 0.0 Protein phosphatase 2C family protein (.1)
Lus10001976 91 / 3e-23 AT3G12620 524 / 0.0 Protein phosphatase 2C family protein (.1.2)
Lus10030302 91 / 3e-23 AT3G12620 597 / 0.0 Protein phosphatase 2C family protein (.1.2)
Lus10040346 85 / 7e-21 AT3G12620 616 / 0.0 Protein phosphatase 2C family protein (.1.2)
Lus10023470 85 / 8e-21 AT3G12620 612 / 0.0 Protein phosphatase 2C family protein (.1.2)
Lus10015047 82 / 9e-20 AT3G55050 476 / 7e-169 Protein phosphatase 2C family protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.001G297200 103 / 8e-28 AT4G33920 563 / 0.0 Protein phosphatase 2C family protein (.1)
Potri.007G051900 102 / 2e-27 AT4G33920 460 / 1e-162 Protein phosphatase 2C family protein (.1)
Potri.009G091600 98 / 7e-26 AT4G33920 561 / 0.0 Protein phosphatase 2C family protein (.1)
Potri.008G046900 87 / 7e-22 AT3G12620 543 / 0.0 Protein phosphatase 2C family protein (.1.2)
Potri.010G214700 86 / 3e-21 AT3G12620 542 / 0.0 Protein phosphatase 2C family protein (.1.2)
Potri.016G045600 85 / 4e-21 AT5G06750 578 / 0.0 Protein phosphatase 2C family protein (.1.2.3)
Potri.016G082800 82 / 4e-20 AT3G12620 502 / 4e-179 Protein phosphatase 2C family protein (.1.2)
Potri.006G192600 81 / 1e-19 AT5G06750 572 / 0.0 Protein phosphatase 2C family protein (.1.2.3)
Potri.005G108500 79 / 9e-19 AT3G51370 646 / 0.0 Protein phosphatase 2C family protein (.1.2)
Potri.004G177100 79 / 9e-19 AT4G38520 608 / 0.0 Protein phosphatase 2C family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0238 PP2C PF00481 PP2C Protein phosphatase 2C
Representative CDS sequence
>Lus10000700 pacid=23155590 polypeptide=Lus10000700 locus=Lus10000700.g ID=Lus10000700.BGIv1.0 annot-version=v1.0
ATGGTGAAGCGATGGTGGATGAACCAGCCGCAGATTGCGTCCGTTGGATTTTGTTGTCTTTTAGGGATAGTGTCCAAGGATTTACTATACGTGGCGAATC
TCGGCGATGCGAGGGTGGTTATGGGGAAGAGAGCTTCTCTGGCGACGGCTGCGGCAGAGCGATTGACCGTCGATCATTATGTTGCTGTTGAGGAGGCCAG
AAGCAAAGTTTTGGCTCTTCATCCCGATGATACTCACATCGTCCTTATACTCGGGGTGTTTGGCGGATAA
AA sequence
>Lus10000700 pacid=23155590 polypeptide=Lus10000700 locus=Lus10000700.g ID=Lus10000700.BGIv1.0 annot-version=v1.0
MVKRWWMNQPQIASVGFCCLLGIVSKDLLYVANLGDARVVMGKRASLATAAAERLTVDHYVAVEEARSKVLALHPDDTHIVLILGVFGG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33920 Protein phosphatase 2C family ... Lus10000700 0 1
AT5G22460 alpha/beta-Hydrolases superfam... Lus10004882 1.0 1.0000
AT1G66950 ABCG39, PDR11, ... ATP-binding cassette G39, plei... Lus10006277 2.0 1.0000
AT1G69940 ATPPME1 Pectin lyase-like superfamily ... Lus10016711 2.2 1.0000
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Lus10017911 2.4 1.0000
AT3G06920 Tetratricopeptide repeat (TPR)... Lus10038657 2.8 1.0000
AT2G37360 ABCG2 ATP-binding cassette G2, ABC-2... Lus10039859 3.0 1.0000
AT2G29670 Tetratricopeptide repeat (TPR)... Lus10025981 3.0 1.0000
AT5G58850 MYB ATMYB119 myb domain protein 119 (.1) Lus10040684 3.2 1.0000
AT5G51740 Peptidase family M48 family pr... Lus10032437 3.5 1.0000
AT1G77460 Armadillo/beta-catenin-like re... Lus10029690 3.6 0.9905

Lus10000700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.